DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and CG18764

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:416 Identity:129/416 - (31%)
Similarity:187/416 - (44%) Gaps:77/416 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTECRICGERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFR 65
            |:.:||.||..|:...|||:|...|.::...|..:||..:..:..||..|||||.|||.||:.||
  Fly     1 MALQCRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFR 65

  Fly    66 QRCLETHANL-HQRISSKAGVASKGSPEV-SP--VLSDPL---------LKREVL---------- 107
            :||:.|...| |:|.|.:|...::...|: ||  .|:||.         ...|||          
  Fly    66 ERCILTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAHHDL 130

  Fly   108 --DDTVDTEDDKELLDDDKDLMDDDKDFLED-----EKPILRYPPAKKIRIEDQNFPNR-----Q 160
              |:.:|:.:|.:.|.|..::.::|...:|.     :|.:      :.|..:|.|..|.     |
  Fly   131 DEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKEL------ESICNDDSNSDNNDYMEPQ 189

  Fly   161 SPRVRVKRLRVPVVEKADSPPPPPREHV----RKPRKRRPKPKVDRSIKRY-------------- 207
            :.....:.:....|....:.|.|..:..    .||...:||.|     |:|              
  Fly   190 NGSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRK-----KQYVTWKNMTEEQIIER 249

  Fly   208 ---------VCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKP 262
                     ||:|||..|.|.||.|.|.|||...| |:|.:||::|||..|:.||.|:.|:||||
  Fly   250 KRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKP 314

  Fly   263 YVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTC 327
            |.|:||...|.||.:|..||| .|.|...:.|..|.|.|.|..||.:||..|...:  ...|..|
  Fly   315 YDCRFCTKSFHNSNTRLIHER-THTNAKPYSCHHCDKCFKSASGRKRHELIHTGVR--AFACTIC 376

  Fly   328 NKEFKEAQFLHRHYSTKYHRKRVNLL 353
            .:.|:....|..|..:|:|..:...:
  Fly   377 KQSFQRNTHLKAHLRSKFHTAKAKTI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 31/72 (43%)
COG5048 <202..343 CDD:227381 61/164 (37%)
C2H2 Zn finger 209..229 CDD:275368 11/19 (58%)
C2H2 Zn finger 236..256 CDD:275368 10/19 (53%)
zf-H2C2_2 249..274 CDD:290200 13/24 (54%)
C2H2 Zn finger 265..283 CDD:275368 8/17 (47%)
C2H2 Zn finger 298..314 CDD:275368 7/15 (47%)
zf-C2H2_jaz 322..347 CDD:288983 6/24 (25%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 30/70 (43%)
C2H2 Zn finger 260..280 CDD:275368 11/19 (58%)
zf-H2C2_2 272..297 CDD:290200 12/24 (50%)
C2H2 Zn finger 288..309 CDD:275368 10/20 (50%)
C2H2 Zn finger 317..337 CDD:275368 10/20 (50%)
C2H2 Zn finger 345..365 CDD:275368 9/19 (47%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450094
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.