DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and vezf1b

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001073432.1 Gene:vezf1b / 556915 ZFINID:ZDB-GENE-060825-121 Length:460 Species:Danio rerio


Alignment Length:167 Identity:51/167 - (30%)
Similarity:78/167 - (46%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKFYTMP 247
            |::....| |:.|||..    |.:.|:.||.:|.|..::..|||.|.:|| |.|..|.::|....
Zfish   174 PQQQPTVP-KKPPKPVK----KNHGCEMCGKAFRDVYHLNRHKLSHSDEKPFECPICHQRFKRKD 233

  Fly   248 LLRLHIRVHHKG-EKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKI--CGKRFNSEKGRLK 309
            .:..|:|.|..| .|||:|..||.||:.......|.:.:|:.|....|::  |...| :.|.||:
Zfish   234 RMTYHVRSHDGGVHKPYICSVCGKGFSRPDHLSCHVKHVHSTERPFKCQVTACTSAF-ATKDRLR 297

  Fly   310 -HEEGHKSDQPDVHICLTCN--KEFKEAQFLHRHYST 343
             |...|:..       :|||  .:...|.::..|..|
Zfish   298 SHMIRHEGK-------VTCNICGKMLSAAYITSHLKT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 44/147 (30%)
C2H2 Zn finger 209..229 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 249..274 CDD:290200 12/25 (48%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 5/16 (31%)
zf-C2H2_jaz 322..347 CDD:288983 6/24 (25%)
C2H2 Zn finger 324..343 CDD:275368 5/20 (25%)
vezf1bNP_001073432.1 C2H2 Zn finger 93..113 CDD:275368
C2H2 Zn finger 194..214 CDD:275368 8/19 (42%)
zf-H2C2_2 206..231 CDD:290200 10/24 (42%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 252..270 CDD:275368 6/17 (35%)
C2H2 Zn finger 281..303 CDD:275368 7/22 (32%)
C2H2 Zn finger 309..328 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.