Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011542525.1 | Gene: | ZNF692 / 55657 | HGNCID: | 26049 | Length: | 625 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 69/267 - (25%) |
---|---|---|---|
Similarity: | 106/267 - (39%) | Gaps: | 42/267 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 RYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPP----------PREHVRKPRKRRP 196
Fly 197 KPKVDRSIKRYVCD--QCGWSFNDHSNMKDH-KLRHFEEK-FSCDE--CGRKFYTMPLLRLHIRV 255
Fly 256 HHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPD 320
Fly 321 VHI-CLTCNKEFKEAQFLHRHYSTKYHRKRVNLLVNGPKEEFQSEVDPA---EFPGYM--EEGQA 379
Fly 380 EMEDNQA 386 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
COG5048 | <202..343 | CDD:227381 | 40/147 (27%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 7/22 (32%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 249..274 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 298..314 | CDD:275368 | 2/15 (13%) | ||
zf-C2H2_jaz | 322..347 | CDD:288983 | 7/25 (28%) | ||
C2H2 Zn finger | 324..343 | CDD:275368 | 5/18 (28%) | ||
ZNF692 | XP_011542525.1 | zf-C2H2 | 465..489 | CDD:278523 | 9/24 (38%) |
C2H2 Zn finger | 467..489 | CDD:275368 | 7/22 (32%) | ||
COG5048 | 490..>591 | CDD:227381 | 27/106 (25%) | ||
zf-C2H2 | 495..517 | CDD:278523 | 8/22 (36%) | ||
C2H2 Zn finger | 497..517 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 509..534 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 525..545 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 556..577 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |