DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and CG6689

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:399 Identity:112/399 - (28%)
Similarity:177/399 - (44%) Gaps:74/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ECRICGERIFTP--HPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQ 66
            :||.| ...||.  ..|::|:..|..:...||.|:|:.|..:...|:.:|..|...|.||:.||:
  Fly   166 KCRTC-YNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFRE 229

  Fly    67 RCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDD------DKD 125
            .|:.|...|.|...|...|..:...| :|:.||    .:::.||.:|  :.|.::|      :.:
  Fly   230 MCISTELKLSQAKPSTDEVQIEAENE-NPISSD----HDLISDTENT--NVEEIEDAGGDHVEDE 287

  Fly   126 LMDDDKDFLEDEKPILRYPPAK---------KI--RIEDQNFPNRQSPRVRVKRLRVPVVEKADS 179
            ...||:...|....:...|.|:         ||  .:.|| :..::..|:   |...|:..|   
  Fly   288 ATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQ-YTGKEKARL---RKGAPIASK--- 345

  Fly   180 PPPPPREHV---RKP-RKRRPKPKVDRSIKR----------YVCDQCGWSFNDHSNMKDHKLRHF 230
              |..:|..   :|| |...||.|.:|::.|          :||||||.:|....|::.|.|||.
  Fly   346 --PKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHT 408

  Fly   231 EEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMH--ANELV- 291
            ..| :.|.||.:.||...:..:|||:.|:||.|:.|.||...||...:|.:||.::|  |..|: 
  Fly   409 RTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIV 473

  Fly   292 ----------------HPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH 340
                            :.||:|.|.:.|:.....|.:.|  ...:.:.|..|:|.:.:...|.||
  Fly   474 KRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSH--TDANAYKCQRCSKSYSDPNKLKRH 536

  Fly   341 YSTKYHRKR 349
            ..|  |.||
  Fly   537 EMT--HEKR 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 24/73 (33%)
COG5048 <202..343 CDD:227381 51/170 (30%)
C2H2 Zn finger 209..229 CDD:275368 9/19 (47%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 11/24 (46%)
C2H2 Zn finger 265..283 CDD:275368 7/17 (41%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 7/24 (29%)
C2H2 Zn finger 324..343 CDD:275368 6/18 (33%)
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 24/73 (33%)
zf-C2H2 385..407 CDD:278523 10/21 (48%)
C2H2 Zn finger 387..407 CDD:275368 9/19 (47%)
zf-H2C2_2 399..422 CDD:290200 9/22 (41%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 6/15 (40%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 7/21 (33%)
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.