DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and topi

DIOPT Version :10

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:117/270 - (43%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EHVRKPRKRRPKPKVDRS---IKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDE--CGRKFY 244
            :|:.|  |:|.|...:..   |::|:||.||.|:...|::..|...|...| |.|.|  |.|||.
  Fly   489 KHLNK--KKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFT 551

  Fly   245 TMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLK 309
            ..|.|..|||..|.||:||:|..||..|.......:| |.:|..|..:.|:.|||||........
  Fly   552 IRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQH-RLIHRGERRYECEECGKRFYRADALKN 615

  Fly   310 HEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLVNGPKEEFQSEVDPAEFPGYM 374
            |:..|..::|  :.||.|.|.|::.....:|...::.....|..:....::||.|...|:   ..
  Fly   616 HQRIHTGEKP--YSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQ---KA 675

  Fly   375 EEGQAEMEDNQ-----AELDV---------------MLDNIDEEQYEDHEVLQDEDANFEDF--E 417
            :....|.:||.     :..||               |..:|..||.|:...:..::.|...|  .
  Fly   676 QSHNPEQQDNDVAGGASTSDVPSGSGFMSTEPSVAEMQYSITPEQQEEMVCVPIDEVNNSFFMSH 740

  Fly   418 YEEAIPDGEE 427
            |.:|:|..|:
  Fly   741 YMQAVPMEED 750

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..78 CDD:462262
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
SUF4-like 212..>257 CDD:411020 19/47 (40%)
C2H2 Zn finger 212..229 CDD:411020 5/16 (31%)
C2H2 Zn finger 236..256 CDD:411020 11/21 (52%)
C2H2 Zn finger 236..256 CDD:275368 11/21 (52%)
zf-H2C2_2 249..274 CDD:463886 13/24 (54%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 5/15 (33%)
zf-C2H2_jaz 322..347 CDD:432381 6/24 (25%)
C2H2 Zn finger 324..343 CDD:275368 6/18 (33%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275370
C2H2 Zn finger 277..297 CDD:275370
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 56/162 (35%)