Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038966377.1 | Gene: | Zbtb48 / 362668 | RGDID: | 1311581 | Length: | 739 | Species: | Rattus norvegicus |
Alignment Length: | 319 | Identity: | 65/319 - (20%) |
---|---|---|---|
Similarity: | 107/319 - (33%) | Gaps: | 104/319 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 SKAGVASKG-----SPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDLMDDDKDFLEDEKPI 140
Fly 141 LRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPKP------- 198
Fly 199 --------------KVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEK---------------- 233
Fly 234 ---------------FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHER 283
Fly 284 Q--MHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
COG5048 | <202..343 | CDD:227381 | 37/172 (22%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 249..274 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 298..314 | CDD:275368 | 2/15 (13%) | ||
zf-C2H2_jaz | 322..347 | CDD:288983 | 5/19 (26%) | ||
C2H2 Zn finger | 324..343 | CDD:275368 | 5/17 (29%) | ||
Zbtb48 | XP_038966377.1 | BTB_POZ_ZBTB48_TZAP_KR3 | 8..115 | CDD:349541 | |
C2H2 Zn finger | 288..308 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 300..323 | CDD:404364 | 11/23 (48%) | ||
C2H2 Zn finger | 316..367 | CDD:275368 | 12/50 (24%) | ||
zf-C2H2 | 345..367 | CDD:395048 | 4/21 (19%) | ||
zf-H2C2_2 | 359..382 | CDD:404364 | 5/24 (21%) | ||
C2H2 Zn finger | 375..396 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 574..595 | CDD:275368 | |||
C2H2 Zn finger | 603..623 | CDD:275368 | |||
zf-H2C2_2 | 616..640 | CDD:404364 | |||
zf-C2H2 | 629..651 | CDD:395048 | |||
C2H2 Zn finger | 631..651 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |