DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and CG31441

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:371 Identity:108/371 - (29%)
Similarity:162/371 - (43%) Gaps:70/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRICGERI--FTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQR 67
            ||.||:.:  .......:|.|.|:.....:|.||.:.:..:..||..||.||.:.|.:.:.||.:
  Fly     8 CRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILTFRNK 72

  Fly    68 CLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDLMDDD-- 130
            |||.|         |:.:|:.         ...|.|:.::|:.:|..|.::|..|..|..|.:  
  Fly    73 CLEVH---------KSFMAAN---------RKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMC 119

  Fly   131 -----------KDFLEDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRV----------PVV 174
                       :|..::||       ||......||..| |..:|:|:...|          .::
  Fly   120 VAMADTAGLLREDHNDNEK-------AKDAEDATQNEKN-QEEQVQVQTEEVEHCQEQLHNMSII 176

  Fly   175 EKADSPPPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDE 238
            .|..|        .|.|::.:      |:.|.:.|||||..|...:.:|.|..||...| |:||.
  Fly   177 SKGVS--------ARVPKRTK------RNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDI 227

  Fly   239 CGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNS 303
            |..|:||...:|.| |:.|...:||.|:||...:....|:..||| .|.||....|:.|.|.|.|
  Fly   228 CQAKYYTDNEMRRH-RILHTDARPYACRFCSKTYRGCSSKVVHER-THTNERPFQCQHCDKAFTS 290

  Fly   304 EKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKR 349
            ...|.|||..| ::|...| |..|::.|..:..|..|.|||.|::|
  Fly   291 TSTRQKHEMLH-TNQRKYH-CEICDQWFLRSSHLTLHQSTKLHQRR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 23/73 (32%)
COG5048 <202..343 CDD:227381 53/141 (38%)
C2H2 Zn finger 209..229 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
zf-H2C2_2 249..274 CDD:290200 9/24 (38%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 7/15 (47%)
zf-C2H2_jaz 322..347 CDD:288983 9/24 (38%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 24/82 (29%)
COG5048 <174..337 CDD:227381 62/179 (35%)
C2H2 Zn finger 197..217 CDD:275370 8/19 (42%)
C2H2 Zn finger 225..245 CDD:275368 9/20 (45%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 268..290 CDD:290200 10/22 (45%)
C2H2 Zn finger 281..301 CDD:275368 9/19 (47%)
C2H2 Zn finger 309..328 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26139
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.