DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and CG11696

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:485 Identity:101/485 - (20%)
Similarity:171/485 - (35%) Gaps:137/485 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRIC------GERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVA 63
            ||:|      |..||...|. :.:..:.::...||:...|.:...:::...:|..|...|.:...
  Fly     3 CRLCLEDAEHGVPIFGQEPP-MGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIEQ 66

  Fly    64 FRQRCLETHANLHQRISSKAGVASKGSPEV-------------SPV----------LSDPLLKRE 105
            |.....|...:||:.:..|..:..  .||:             ||:          :.|.:|...
  Fly    67 FCSMVAEKQRSLHRSLQLKTELPE--LPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCEP 129

  Fly   106 VLD-------------DTVDTEDDKELLDDDKDLMDDD-----------KDFLEDEKPIL--RYP 144
            |:|             ||.:.:.:.|...|:::..:.|           |..|:....|:  :|.
  Fly   130 VIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYE 194

  Fly   145 PAK---KIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPP------------PPPREHVRKPRKR 194
            ..|   |.:|.:.:....::.:..:||......:..|...            .|..:...|||.:
  Fly   195 KRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGK 259

  Fly   195 RPKPKVDR------------------SIKR---YV-------CDQCGWSFNDHSNMKDHKLRHFE 231
            |.:||..:                  |||.   |:       |..|.....|.:::|    |||.
  Fly   260 RGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFNDLK----RHFR 320

  Fly   232 EKFSCDE----CGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHA--NEL 290
            .:..|..    |..::....|...|:.. ||..:.:.|:.|...|.|..|:..|..:.|:  .||
  Fly   321 VEHDCTGYVKCCNNRYKKRTLYVDHLHC-HKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQEL 384

  Fly   291 VHPCKICGKRFNSEKGRLKHEEGHK-SDQPDVHICLTCNKEFKEAQFLHRHYST----------- 343
            ||.|.||..||..:.....|.:||| :::|:|  |.||:|.|:....|..|...           
  Fly   385 VHQCAICEARFAKKFLLTMHLKGHKGTERPEV--CDTCSKTFRTKFELSAHVKRMHAADFTPIIC 447

  Fly   344 ----KYHRKRVNLLV-------NGPKEEFQ 362
                .:.|.:.|.|:       :||..|.|
  Fly   448 DICGTHFRSKANFLIHKKALHPDGPVAEVQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 16/77 (21%)
COG5048 <202..343 CDD:227381 46/175 (26%)
C2H2 Zn finger 209..229 CDD:275368 4/19 (21%)
C2H2 Zn finger 236..256 CDD:275368 4/23 (17%)
zf-H2C2_2 249..274 CDD:290200 6/24 (25%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 7/39 (18%)
C2H2 Zn finger 324..343 CDD:275368 7/18 (39%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 15/75 (20%)
C2H2 Zn finger 332..349 CDD:275368 3/17 (18%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 3/17 (18%)
C2H2 Zn finger 478..498 CDD:275368 101/485 (21%)
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.