Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006236507.1 | Gene: | Zfp212 / 297066 | RGDID: | 1307836 | Length: | 492 | Species: | Rattus norvegicus |
Alignment Length: | 437 | Identity: | 83/437 - (18%) |
---|---|---|---|
Similarity: | 131/437 - (29%) | Gaps: | 176/437 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 FEKRNHRIRMAIE---QITGLEIVLENMLPQHICACCLLDLTQAVAFRQRCLETHANLHQRISSK 82
Fly 83 AGVASKGSPEVSPVLSDPL---------------------LKREVLDDTVDT----------EDD 116
Fly 117 KE--------LLDDDKDLMD--------------------------DDKDFLEDEKPILRYPPAK 147
Fly 148 KIRIE----DQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPK----------- 197
Fly 198 -PKVDRSIKRYVCDQCGWSF----------NDHSNMKDHKLRHFEEKF----------------S 235
Fly 236 CDECGRKFYTMPLLRLHIRVHHK----------------------GEKPY-------VCKFCGMG 271
Fly 272 FANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQ 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | 17/58 (29%) |
COG5048 | <202..343 | CDD:227381 | 36/172 (21%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 5/29 (17%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 249..274 | CDD:290200 | 10/53 (19%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 298..314 | CDD:275368 | 4/15 (27%) | ||
zf-C2H2_jaz | 322..347 | CDD:288983 | |||
C2H2 Zn finger | 324..343 | CDD:275368 | |||
Zfp212 | XP_006236507.1 | KRAB_A-box | 142..180 | CDD:143639 | 6/37 (16%) |
zf-C2H2 | 313..335 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 4/19 (21%) | ||
COG5048 | <329..>474 | CDD:227381 | 29/145 (20%) | ||
C2H2 Zn finger | 368..388 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/20 (35%) | ||
zf-C2H2 | 426..446 | CDD:278523 | 7/20 (35%) | ||
zf-H2C2_2 | 438..463 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |