DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and ZNF707

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001094068.1 Gene:ZNF707 / 286075 HGNCID:27815 Length:371 Species:Homo sapiens


Alignment Length:260 Identity:65/260 - (25%)
Similarity:97/260 - (37%) Gaps:77/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPP-PREHV-----RKP--RKRRPKPKVDRSI 204
            ::..:|...| |.:|            |:.|:.|.. |.:.:     |:|  |:||.:..|:.|.
Human   125 RLDTDDGQLP-RAAP------------ERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSF 176

  Fly   205 -------------------------KRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKF 243
                                     |.:.|.:||.:|...||::.|:..|..|| |.|:.||:.|
Human   177 ICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEACGQAF 241

  Fly   244 YTMPLLRLHIRVH---------------------------HKGEKPYVCKFCGMGFANSPSRCRH 281
            .....|..|.:||                           |.||:|:.|..||..|....:...|
Human   242 SLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCADCGKAFRTKENLSHH 306

  Fly   282 ERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYH 346
            :| :|:.|..:.|..|||.|...||...|...|.:.:  .:.|..|.|.|:...|..||..|..|
Human   307 QR-VHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKR--FYECGHCGKGFRHLGFFTRHQRTHRH 368

  Fly   347  346
            Human   369  368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 49/193 (25%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 249..274 CDD:290200 12/51 (24%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 6/15 (40%)
zf-C2H2_jaz 322..347 CDD:288983 9/25 (36%)
C2H2 Zn finger 324..343 CDD:275368 7/18 (39%)
ZNF707NP_001094068.1 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..143 5/30 (17%)
C2H2 Zn finger 178..198 CDD:275368 0/19 (0%)
COG5048 <187..366 CDD:227381 48/181 (27%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 9/23 (39%)
C2H2 Zn finger 234..254 CDD:275368 6/19 (32%)
zf-C2H2 260..282 CDD:278523 0/21 (0%)
C2H2 Zn finger 262..282 CDD:275368 0/19 (0%)
zf-H2C2_2 274..299 CDD:290200 8/24 (33%)
C2H2 Zn finger 290..310 CDD:275368 6/20 (30%)
zf-H2C2_2 302..325 CDD:290200 8/23 (35%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.