Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094068.1 | Gene: | ZNF707 / 286075 | HGNCID: | 27815 | Length: | 371 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 65/260 - (25%) |
---|---|---|---|
Similarity: | 97/260 - (37%) | Gaps: | 77/260 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 KIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPP-PREHV-----RKP--RKRRPKPKVDRSI 204
Fly 205 -------------------------KRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKF 243
Fly 244 YTMPLLRLHIRVH---------------------------HKGEKPYVCKFCGMGFANSPSRCRH 281
Fly 282 ERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYH 346
Fly 347 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
COG5048 | <202..343 | CDD:227381 | 49/193 (25%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 249..274 | CDD:290200 | 12/51 (24%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 298..314 | CDD:275368 | 6/15 (40%) | ||
zf-C2H2_jaz | 322..347 | CDD:288983 | 9/25 (36%) | ||
C2H2 Zn finger | 324..343 | CDD:275368 | 7/18 (39%) | ||
ZNF707 | NP_001094068.1 | KRAB | 8..68 | CDD:214630 | |
KRAB | 8..47 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..143 | 5/30 (17%) | |||
C2H2 Zn finger | 178..198 | CDD:275368 | 0/19 (0%) | ||
COG5048 | <187..366 | CDD:227381 | 48/181 (27%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 218..242 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 234..254 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 260..282 | CDD:278523 | 0/21 (0%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 274..299 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 290..310 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 302..325 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |