DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and ZNF660

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_775929.2 Gene:ZNF660 / 285349 HGNCID:26720 Length:331 Species:Homo sapiens


Alignment Length:154 Identity:53/154 - (34%)
Similarity:81/154 - (52%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 KVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKP 262
            :|....::|||.:||.:|:..:|:..|:..|..|| :.|.|||:.|.....|.:|.|: |.|.||
Human    42 RVQAEKRQYVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRI-HTGLKP 105

  Fly   263 YVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTC 327
            |.|..||..|:......||: .:|:.|..:.||.|||.|:...|.:.|...|..::|  :.|:.|
Human   106 YTCSECGKSFSGKSHLIRHQ-GIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKP--YSCIEC 167

  Fly   328 NKEFKEAQFLHRHYSTKYHR-KRV 350
            .|.|..:..|.:|  .:.|| |:|
Human   168 GKAFSRSSNLTQH--QRMHRGKKV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 48/141 (34%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 12/24 (50%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 5/15 (33%)
zf-C2H2_jaz 322..347 CDD:288983 6/24 (25%)
C2H2 Zn finger 324..343 CDD:275368 6/18 (33%)
ZNF660NP_775929.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
zf-H2C2_2 64..89 CDD:316026 10/24 (42%)
C2H2 Zn finger 80..100 CDD:275368 8/20 (40%)
COG5048 <107..294 CDD:227381 28/88 (32%)
C2H2 Zn finger 108..128 CDD:275368 6/20 (30%)
C2H2 Zn finger 136..156 CDD:275368 8/19 (42%)
C2H2 Zn finger 164..184 CDD:275368 6/21 (29%)
C2H2 Zn finger 192..207 CDD:275368
C2H2 Zn finger 220..240 CDD:275368
C2H2 Zn finger 248..268 CDD:275368
C2H2 Zn finger 276..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.