DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and klf-3

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:191 Identity:43/191 - (22%)
Similarity:71/191 - (37%) Gaps:44/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PPAKKIRIEDQNFPNRQSP---RVRVKRLRVPV--------VEKADSPPPPPREHVRKPRKRRPK 197
            ||..||.....:..|...|   ::...::.:|:        ::...|.|.......|.|.:|:  
 Worm   150 PPTHKIETPPSSPENSFGPLASQLPAIKMEIPMHPLPHNGELDSTRSSPSSTTSSERSPLQRK-- 212

  Fly   198 PKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEKF---SC--DECGRKFYTMPLLRLHIRVHH 257
                                  |.::.:|....::||   :|  ..|.:|:.....|:.|.|. |
 Worm   213 ----------------------SRIESNKRNPTDKKFVVHACTYPGCFKKYSKSSHLKAHERT-H 254

  Fly   258 KGEKPYVCKF--CGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKS 316
            .||||:|||:  |...||.|....||.|: |..:....|.:|.:.|........|.:.|.:
 Worm   255 SGEKPFVCKWQNCSWKFARSDELTRHMRK-HTGDKPFRCSLCDRNFARSDHLSLHMKRHST 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 31/122 (25%)
C2H2 Zn finger 209..229 CDD:275368 2/19 (11%)
C2H2 Zn finger 236..256 CDD:275368 6/21 (29%)
zf-H2C2_2 249..274 CDD:290200 13/26 (50%)
C2H2 Zn finger 265..283 CDD:275368 8/19 (42%)
C2H2 Zn finger 298..314 CDD:275368 2/15 (13%)
zf-C2H2_jaz 322..347 CDD:288983
C2H2 Zn finger 324..343 CDD:275368
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..284 CDD:275368 9/22 (41%)
zf-H2C2_2 276..301 CDD:290200 7/25 (28%)
C2H2 Zn finger 292..312 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.