Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011524789.1 | Gene: | ZNF524 / 147807 | HGNCID: | 28322 | Length: | 370 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 68/265 - (25%) |
---|---|---|---|
Similarity: | 95/265 - (35%) | Gaps: | 58/265 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 135 EDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPKPK 199
Fly 200 V---------------------DRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEKFSCDECGRKF 243
Fly 244 YTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRL 308
Fly 309 KHEEG-HKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLVNGPKEEFQSEVDPAEFPG 372
Fly 373 YMEEG 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
COG5048 | <202..343 | CDD:227381 | 42/141 (30%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 249..274 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 8/17 (47%) | ||
C2H2 Zn finger | 298..314 | CDD:275368 | 6/16 (38%) | ||
zf-C2H2_jaz | 322..347 | CDD:288983 | 9/24 (38%) | ||
C2H2 Zn finger | 324..343 | CDD:275368 | 8/18 (44%) | ||
ZNF524 | XP_011524789.1 | COG5048 | <219..>283 | CDD:227381 | 23/70 (33%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 5/22 (23%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 290..314 | CDD:290200 | 6/25 (24%) | ||
C2H2 Zn finger | 306..327 | CDD:275368 | 9/21 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |