DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and ZNF358

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_060553.4 Gene:ZNF358 / 140467 HGNCID:16838 Length:568 Species:Homo sapiens


Alignment Length:337 Identity:74/337 - (21%)
Similarity:118/337 - (35%) Gaps:88/337 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LHQRISSKAGVASKGSPEVSPVLSDPLLKRE----VLDDTVDTEDDKELLDDDKD---------- 125
            :::.:.|.:........::.||..||....|    |.:|...:.:|.|.:.:|.|          
Human    18 VYEELDSDSEDLDPNPEDLDPVSEDPEPDPEDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEP 82

  Fly   126 ----------------------LMDDDKDFLEDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKR 168
                                  ::|.:.|.|....|          :::..:.....:|:|....
Human    83 QDPDPMSSSFDLDPDVIGPVPLILDPNSDTLSPGDP----------KVDPISSGLTATPQVLATS 137

  Fly   169 LRVPVVEKADSPPPPP----------------REHVRKPRKRRPK--PKVDRSI----------- 204
               |.|..|.:.||.|                .:|.|.....:|.  |...:|.           
Human   138 ---PAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRG 199

  Fly   205 -----KRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKPY 263
                 :.|.|..||.:|...|.:..|:..|..|| ..|..||:.|....||..|:|. |.|.:|:
Human   200 IHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRT-HGGPRPH 263

  Fly   264 VCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCN 328
            .|..|..||....:..:|.| .|..|..:||..|||.|......|:|:..|.:::|  :.|..|.
Human   264 KCPVCAKGFGQGSALLKHLR-THTGERPYPCPQCGKAFGQSSALLQHQRTHTAERP--YRCPHCG 325

  Fly   329 KEFKEAQFLHRH 340
            |.|.::..|..|
Human   326 KAFGQSSNLQHH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 0/1 (0%)
COG5048 <202..343 CDD:227381 46/156 (29%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 10/24 (42%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 5/15 (33%)
zf-C2H2_jaz 322..347 CDD:288983 6/19 (32%)
C2H2 Zn finger 324..343 CDD:275368 6/17 (35%)
ZNF358NP_060553.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 15/98 (15%)
COG5048 <35..339 CDD:227381 73/320 (23%)
lambda-1 108..>174 CDD:212564 13/78 (17%)
zf-C2H2 151..173 CDD:278523 2/21 (10%)
C2H2 Zn finger 153..173 CDD:275368 2/19 (11%)
zf-H2C2_2 166..190 CDD:290200 5/23 (22%)
C2H2 Zn finger 181..201 CDD:275368 2/19 (11%)
zf-H2C2_2 194..216 CDD:290200 4/21 (19%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
zf-H2C2_2 222..244 CDD:290200 7/21 (33%)
C2H2 Zn finger 237..257 CDD:275368 8/20 (40%)
zf-H2C2_2 250..272 CDD:290200 8/22 (36%)
C2H2 Zn finger 265..285 CDD:275368 6/20 (30%)
zf-H2C2_2 277..300 CDD:290200 9/23 (39%)
zf-C2H2_8 292..370 CDD:292531 16/48 (33%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-H2C2_2 305..328 CDD:290200 7/24 (29%)
C2H2 Zn finger 321..341 CDD:275368 6/17 (35%)
zf-H2C2_2 333..356 CDD:290200 2/5 (40%)
C2H2 Zn finger 349..369 CDD:275368
zf-H2C2_2 361..384 CDD:290200
zf-C2H2 375..397 CDD:278523
C2H2 Zn finger 377..397 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.