Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006228368.1 | Gene: | LOC100911196 / 100911196 | RGDID: | 6494165 | Length: | 1059 | Species: | Rattus norvegicus |
Alignment Length: | 212 | Identity: | 55/212 - (25%) |
---|---|---|---|
Similarity: | 80/212 - (37%) | Gaps: | 64/212 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 HVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGRKFYTMPLLR 250
Fly 251 LHIRVHHKGEKPYVCKFCGMGFANS--------------PSRC--------------RHERQMHA 287
Fly 288 NELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH------------ 340
Fly 341 ----------YSTKYHR 347 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |