DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and Zfp518b

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001074613.2 Gene:Zfp518b / 100515 MGIID:2140750 Length:1082 Species:Mus musculus


Alignment Length:225 Identity:56/225 - (24%)
Similarity:86/225 - (38%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 NFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDH 219
            :|.|..:....|:.    ..|...||       |.|.:.|..||      .:|.||:|.:|..|.
Mouse   103 HFVNNNAGAAHVRN----ETETISSP-------VNKFKVRNFKP------GKYYCDKCRFSTKDP 150

  Fly   220 SNMKDHKLRHFEEKFSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQ 284
            ...:.|.|:|.|.:|.|..|....||....:.|: |.|.|..||.|::|..|...:....:|.|:
Mouse   151 LQYRKHTLQHEEIRFICSHCSYISYTKGEFQRHL-VKHTGIFPYRCEYCDYGAIRNDYIVKHRRR 214

  Fly   285 MHANE-LVHP----CKICGKRFNSEKGRLKHEEGHK---------SDQPDVHICLTCNKEFKEAQ 335
            :|... ...|    .|:..||.:..|..::..:|..         |||.. ...|..||:     
Mouse   215 VHERAGAKRPFKTVAKLEPKRTSIPKQSMELSKGPSPRAAFQNKLSDQLS-RFSLHANKD----- 273

  Fly   336 FLHRHYSTKYHRKRVNLLVNGPKEEFQSEV 365
                    |.|    ||::....:::|.:|
Mouse   274 --------KTH----NLMLLPELKKYQKDV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 39/154 (25%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 249..274 CDD:290200 9/24 (38%)
C2H2 Zn finger 265..283 CDD:275368 4/17 (24%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 4/24 (17%)
C2H2 Zn finger 324..343 CDD:275368 3/18 (17%)
Zfp518bNP_001074613.2 C2H2 Zn finger 140..160 CDD:275368 7/19 (37%)
zf-H2C2_5 167..189 CDD:372805 7/22 (32%)
C2H2 Zn finger 167..187 CDD:275368 6/20 (30%)
C2H2 Zn finger 195..216 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8154
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.