Sequence 1: | NP_650660.2 | Gene: | CG17801 / 42144 | FlyBaseID: | FBgn0038550 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358837.1 | Gene: | GFI1B / 8328 | HGNCID: | 4238 | Length: | 352 | Species: | Homo sapiens |
Alignment Length: | 309 | Identity: | 80/309 - (25%) |
---|---|---|---|
Similarity: | 111/309 - (35%) | Gaps: | 85/309 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 KKAEESDIDLNLAHEDRRNEP--------HNPYDSETPLIFKHKNPLIETPSFANENLPNKV--- 173
Fly 174 --DAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCG 236
Fly 237 RVFKTPYNLKTHMVR-HTGEKNFPCTFCDKRFVTKYLARLHERVRHMG----------------- 283
Fly 284 ----EQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFL------- 337
Fly 338 ---------------------HSGLKPFDCVICQINFARKATLRSHFDS 365 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17801 | NP_650660.2 | zf-AD | 9..74 | CDD:285071 | |
zf-C2H2 | 231..252 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 232..252 | CDD:275368 | 10/20 (50%) | ||
zf-H2C2_2 | 244..269 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 260..281 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | 8/47 (17%) | ||
C2H2 Zn finger | 346..362 | CDD:275368 | 7/15 (47%) | ||
GFI1B | NP_001358837.1 | C2H2 Zn finger | 165..186 | CDD:275368 | 10/20 (50%) |
C2H2 Zn finger | 194..214 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 7/20 (35%) | ||
COG5048 | 252..>329 | CDD:227381 | 19/77 (25%) | ||
C2H2 Zn finger | 272..292 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 284..309 | CDD:372612 | 2/24 (8%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | 0/19 (0%) | ||
C2H2 Zn finger | 328..345 | CDD:275368 | 7/16 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |