DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and GFI1B

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001358837.1 Gene:GFI1B / 8328 HGNCID:4238 Length:352 Species:Homo sapiens


Alignment Length:309 Identity:80/309 - (25%)
Similarity:111/309 - (35%) Gaps:85/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KKAEESDIDLNLAHEDRRNEP--------HNPYDSETPLIFKHKNPLIETPSFANENLPNKV--- 173
            |:..|.:.|.|||    |..|        ..|.|.::||   ..:|....|||:.:.|....   
Human    61 KREPELEQDQNLA----RMAPAPEGPIVLSRPQDGDSPL---SDSPPFYKPSFSWDTLATTYGHS 118

  Fly   174 --DAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCG 236
              .|.|..:..|::....|......||.:.....:|              |.:..|.:..|.||.
Human   119 YRQAPSTMQSAFLEHSVSLYGSPLVPSTEPALDFSL--------------RYSPGMDAYHCVKCN 169

  Fly   237 RVFKTPYNLKTHMVR-HTGEKNFPCTFCDKRFVTKYLARLHERVRHMG----------------- 283
            :||.||:.|:.|:.| |:|.:.|.|..|.|.|........|..|...|                 
Human   170 KVFSTPHGLEVHVRRSHSGTRPFACDICGKTFGHAVSLEQHTHVHSQGIPAGSSPEPAPDPPGPH 234

  Fly   284 ----EQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFL------- 337
                |:.|||..|...|..|:..|:|..| |.....|.|..|.|||:.|:.:.||.::       
Human   235 FLRQERSFECRMCGKAFKRSSTLSTHLLI-HSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPH 298

  Fly   338 ---------------------HSGLKPFDCVICQINFARKATLRSHFDS 365
                                 |:|.|||.|.:|...|.||..||.|.:|
Human   299 KCQVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRES 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071
zf-C2H2 231..252 CDD:278523 10/21 (48%)
C2H2 Zn finger 232..252 CDD:275368 10/20 (50%)
zf-H2C2_2 244..269 CDD:290200 10/25 (40%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 8/47 (17%)
C2H2 Zn finger 346..362 CDD:275368 7/15 (47%)
GFI1BNP_001358837.1 C2H2 Zn finger 165..186 CDD:275368 10/20 (50%)
C2H2 Zn finger 194..214 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/20 (35%)
COG5048 252..>329 CDD:227381 19/77 (25%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
zf-H2C2_2 284..309 CDD:372612 2/24 (8%)
C2H2 Zn finger 300..320 CDD:275368 0/19 (0%)
C2H2 Zn finger 328..345 CDD:275368 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.