DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and ZNF225

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001308614.1 Gene:ZNF225 / 7768 HGNCID:13018 Length:706 Species:Homo sapiens


Alignment Length:132 Identity:51/132 - (38%)
Similarity:73/132 - (55%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSAT 295
            :|.|||:.|.....|:.|...|||||.|.|..|.|.|.::.....|..| ||.|:||.|:.|..:
Human   261 ICEKCGKAFIHDSQLQEHQRIHTGEKPFKCDICCKSFRSRANLNRHSMV-HMREKPFRCDTCGKS 324

  Fly   296 FFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLR 360
            |...:|.:|| |:.|..:.||:|::|.|||..:..|.||:..|:|.||::|..|..:|...:.|.
Human   325 FGLKSALNSH-RMVHTGEKRYKCEECGKRFIYRQDLYKHQIDHTGEKPYNCKECGKSFRWASGLS 388

  Fly   361 SH 362
            .|
Human   389 RH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071
zf-C2H2 231..252 CDD:278523 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 12/24 (50%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
ZNF225NP_001308614.1 KRAB 8..48 CDD:307490
C2H2 Zn finger 153..170 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
COG5048 202..634 CDD:227381 51/132 (39%)
C2H2 Zn finger 206..226 CDD:275368
C2H2 Zn finger 234..254 CDD:275368
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..310 CDD:275368 6/20 (30%)
C2H2 Zn finger 318..338 CDD:275368 7/20 (35%)
C2H2 Zn finger 346..366 CDD:275368 8/19 (42%)
C2H2 Zn finger 374..394 CDD:275368 5/17 (29%)
C2H2 Zn finger 402..422 CDD:275368
C2H2 Zn finger 430..450 CDD:275368
C2H2 Zn finger 458..478 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
C2H2 Zn finger 514..534 CDD:275368
C2H2 Zn finger 542..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..618 CDD:275368
C2H2 Zn finger 626..646 CDD:275368
C2H2 Zn finger 654..672 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.