DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17801 and ZNF221

DIOPT Version :9

Sequence 1:	NP_650660.2	Gene:	CG17801 / 42144	FlyBaseID:	FBgn0038550	Length:	381	Species:	Drosophila melanogaster
Sequence 2:	NP_001284517.1	Gene:	ZNF221 / 7638	HGNCID:	13014	Length:	617	Species:	Homo sapiens

Alignment Length:	137	Identity:	51/137 - (37%)
Similarity:	75/137 - (54%)	Gaps:	4/137 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   232 CPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATF 296
            |..||:.|....:|:||...|||||.|.|..|.|.|.::....:|.:: |.||:|:.|..|...|
Human   228 CDVCGKEFNQSSHLQTHQRVHTGEKPFKCGQCGKGFHSRSALNVHCKL-HTGEKPYNCEECGKAF 291

  Fly   297 FTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRS 361
            ...:....|:|| |..:..::||.|.|.|..::.||:|..:|:|.|||.|..|..||.:::.|.|
Human   292 IHDSQLQEHQRI-HTGEKPFKCDICGKSFRVRSRLNRHSMVHTGEKPFRCDTCGKNFRQRSALNS 355

  Fly   362 HFDSVAH 368
            |  |:.|
Human   356 H--SMVH 360

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17801	NP_650660.2	zf-AD	9..74	CDD:285071
		zf-C2H2	231..252	CDD:278523	7/19 (37%)
		C2H2 Zn finger	232..252	CDD:275368	7/19 (37%)
		zf-H2C2_2	244..269	CDD:290200	13/24 (54%)
		C2H2 Zn finger	260..281	CDD:275368	5/20 (25%)
		C2H2 Zn finger	289..308	CDD:275368	4/18 (22%)
		C2H2 Zn finger	318..338	CDD:275368	8/19 (42%)
		C2H2 Zn finger	346..362	CDD:275368	5/15 (33%)
ZNF221	NP_001284517.1	KRAB	30..70	CDD:307490
		COG5048	166..576	CDD:227381	51/137 (37%)
		C2H2 Zn finger	172..192	CDD:275368
		C2H2 Zn finger	200..220	CDD:275368
		C2H2 Zn finger	228..248	CDD:275368	7/19 (37%)
		C2H2 Zn finger	256..276	CDD:275368	5/20 (25%)
		C2H2 Zn finger	284..304	CDD:275368	6/20 (30%)
		C2H2 Zn finger	312..332	CDD:275368	8/19 (42%)
		C2H2 Zn finger	340..360	CDD:275368	8/21 (38%)
		C2H2 Zn finger	368..388	CDD:275368
		C2H2 Zn finger	396..416	CDD:275368
		C2H2 Zn finger	424..444	CDD:275368
		C2H2 Zn finger	452..472	CDD:275368
		C2H2 Zn finger	480..500	CDD:275368
		C2H2 Zn finger	508..528	CDD:275368
		C2H2 Zn finger	536..556	CDD:275368
		C2H2 Zn finger	564..584	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910