Sequence 1: | NP_650660.2 | Gene: | CG17801 / 42144 | FlyBaseID: | FBgn0038550 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001360962.1 | Gene: | BC024063 / 666584 | MGIID: | 2670978 | Length: | 749 | Species: | Mus musculus |
Alignment Length: | 131 | Identity: | 51/131 - (38%) |
---|---|---|---|
Similarity: | 74/131 - (56%) | Gaps: | 2/131 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 232 CPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATF 296
Fly 297 FTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRS 361
Fly 362 H 362 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |