DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and ZNF492

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_065906.1 Gene:ZNF492 / 57615 HGNCID:23707 Length:531 Species:Homo sapiens


Alignment Length:382 Identity:91/382 - (23%)
Similarity:150/382 - (39%) Gaps:85/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PTIIFCLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRV------------- 73
            |.:|.|||   :.|:...:...:...:|..:|.....||......|...|:|             
Human    18 PDLITCLE---QGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKKNYFQKVILRRYKKCGCENL 79

  Fly    74 --------HNEATLRRE--SGLDEDLESTVSDIEP---------EGDSSDLESEESYDSENYPFD 119
                    .:|..:.:|  :||::.|.:|.:.|..         :..:|:..:......:::.. 
Human    80 QLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVKVFHKFSNSNRHTIRHTGKKSFKC- 143

  Fly   120 KKAEESDIDL-NLAHEDRRNEPHNPYD--------SETPLIFKHKNPLIETPSFANENLPNKVDA 175
            |:.|:|...| :||...|.:....||.        :||..:..||.  |.|             .
Human   144 KECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNETSNLSTHKR--IHT-------------G 193

  Fly   176 KSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFK 240
            |.|.|..  :.|.....|:...:.|::                   .|.:|...  |.:||:.|.
Human   194 KKPYKCE--ECGKAFNRLSHLTTHKII-------------------HTGKKPYK--CEECGKAFN 235

  Fly   241 TPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSH 305
            ...||.||...|||||.:.|..|.:.|........| ::.|.||:|::|..|...|..|:..::|
Human   236 QSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAH-KIIHAGEKPYKCEECGKAFSQSSTLTTH 299

  Fly   306 ERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSH 362
             :|.|..:..|:|::|.|.|:..:.|..||.:|||.||:.|..|...|.:.:||.:|
Human   300 -KIIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 13/72 (18%)
zf-C2H2 231..252 CDD:278523 8/20 (40%)
C2H2 Zn finger 232..252 CDD:275368 8/19 (42%)
zf-H2C2_2 244..269 CDD:290200 12/24 (50%)
C2H2 Zn finger 260..281 CDD:275368 4/20 (20%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
ZNF492NP_065906.1 KRAB <1..32 CDD:214630 6/16 (38%)
COG5048 138..522 CDD:227381 70/259 (27%)
C2H2 Zn finger 143..163 CDD:275368 7/20 (35%)
zf-H2C2_2 155..179 CDD:290200 5/23 (22%)
C2H2 Zn finger 171..191 CDD:275368 4/21 (19%)
zf-H2C2_2 183..208 CDD:290200 8/41 (20%)
C2H2 Zn finger 199..219 CDD:275368 3/40 (8%)
zf-H2C2_2 211..236 CDD:290200 7/45 (16%)
C2H2 Zn finger 227..247 CDD:275368 8/19 (42%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 4/20 (20%)
C2H2 Zn finger 283..303 CDD:275368 6/20 (30%)
C2H2 Zn finger 311..331 CDD:275368 7/19 (37%)
zf-H2C2_2 323..348 CDD:290200 11/24 (46%)
C2H2 Zn finger 339..359 CDD:275368 6/17 (35%)
C2H2 Zn finger 367..387 CDD:275368
zf-H2C2_2 379..403 CDD:290200
C2H2 Zn finger 395..415 CDD:275368
zf-H2C2_2 408..432 CDD:290200
C2H2 Zn finger 423..443 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
zf-H2C2_2 463..488 CDD:290200
C2H2 Zn finger 479..499 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.