DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG1792

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:376 Identity:112/376 - (29%)
Similarity:172/376 - (45%) Gaps:56/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CASC----FCHLNPTIIFCLE-----VLAKIKDLTGIWL---EQNERQPRHICPSCLNDLNTSIK 65
            |.:|    ||. .|:.:|  |     :|.:|:.|||::|   ..||..| .||..|..||.|:|.
  Fly     6 CRTCGLFIFCS-TPSNLF--EEPNSVMLHQIEVLTGLFLLGGPGNELPP-FICSPCELDLQTAIA 66

  Fly    66 LKKRIQRVHNEATLRRESGLD--EDLESTVSDIEPEGDSSDLESEESYDSENYPFDKKAEESDID 128
            .::|:  :..:.||:....|.  |.:||....:         |.|..|..|      ..|...||
  Fly    67 FRERV--IRTQKTLQESPNLGNAELIESFAVGV---------EKEIQYAEE------VTEIEVID 114

  Fly   129 LNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLL 193
            | |..|....|...||:    :..:::.|.::.|  |.|....:....:|.....::...:.:..
  Fly   115 L-LPEEHLLEETEEPYE----ICEQNEQPQVKVP--AQEKKLRRSTKTTPTVFTSVKFADNSQAT 172

  Fly   194 TTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNF 258
            .|..|       .|..::|.|     .||..|| :..:|.:|||.|..|.|.|.|::||||.|:|
  Fly   173 RTQWS-------RLTEDEVVA-----LKRERRK-RDCICEQCGRHFTCPSNFKLHLLRHTGVKSF 224

  Fly   259 PCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTK 323
            .|..|.::|.|..|.|.|:.: |.|...|:|.:|.||:..::.:..|||:||.....:.|.:|.|
  Fly   225 ACDQCSQQFYTATLLRRHQEL-HAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNK 288

  Fly   324 RFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRASA 374
            .|.....|..|...|:|::.|.|..||::|.|::.|.||:.|..|...:||
  Fly   289 SFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 24/72 (33%)
zf-C2H2 231..252 CDD:278523 9/20 (45%)
C2H2 Zn finger 232..252 CDD:275368 9/19 (47%)
zf-H2C2_2 244..269 CDD:290200 12/24 (50%)
C2H2 Zn finger 260..281 CDD:275368 7/20 (35%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
C2H2 Zn finger 346..362 CDD:275368 6/15 (40%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/79 (33%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 6/16 (38%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.