DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and trem

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:438 Identity:107/438 - (24%)
Similarity:171/438 - (39%) Gaps:98/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CHLCASCFCHLNPT-------IIFCLEVLAKIKDL----TGIWLEQNERQPRHICPSCLNDLNTS 63
            |.:|.:     ||:       .||......::..:    .||.:..::..|..:|..|:..|...
  Fly    12 CRVCLN-----NPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLDDNFPDKMCSKCVRCLRLC 71

  Fly    64 IKLKKRIQRVH--------NEATLRRESGLDEDLESTVSDIEPEGDSSDLESEESY--------- 111
            .|.:...||.|        .||:....:| :.||.|...|:..|   |.|:|.|.|         
  Fly    72 YKFRLTCQRSHQHIMDMLDREASNANAAG-EGDLLSIAEDLSVE---SVLKSWEDYASQLDGGMK 132

  Fly   112 -----DSENYPFDKKAEESDI-DLNL--AHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANEN 168
                 |.::.......|:.|. |.|:  .|:..:..|:...::||...::      |.....|||
  Fly   133 VEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYE------EYELLTNEN 191

  Fly   169 LPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAK--RTAR------ 225
            .|.....|.       ..|||: .....|..::.:.:..:.||....:..|.|  |:.|      
  Fly   192 SPEIAQEKG-------STGTDV-ATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYH 248

  Fly   226 -------------------KMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKY 271
                               |:.:.:|..||.::.|...|..||..|:|.|...|..|.:.||.. 
  Fly   249 KNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQN- 312

  Fly   272 LARLHERVRHM----GEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLN 332
                .:.||||    |.:|::||:|.|.|...:.|:.|.|| |.::..|.||.|::.|.....|.
  Fly   313 ----QQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRI-HTKERPYVCDVCSRTFTYSDNLK 372

  Fly   333 KHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRASAILESEE 380
            .||.:|:|.||..|.:|...|.:...||.|.::  |.:|.:...::||
  Fly   373 FHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRET--HNRRITWRNDAEE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 15/74 (20%)
zf-C2H2 231..252 CDD:278523 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 9/24 (38%)
C2H2 Zn finger 260..281 CDD:275368 5/20 (25%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 16/79 (20%)
COG5048 <264..411 CDD:227381 51/154 (33%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 8/24 (33%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 9/20 (45%)
zf-H2C2_2 345..367 CDD:290200 9/22 (41%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 9/23 (39%)
C2H2 Zn finger 386..406 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.