DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and Odj

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:388 Identity:103/388 - (26%)
Similarity:167/388 - (43%) Gaps:55/388 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQCHLCASCFCHLNPTIIF---CLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKR 69
            ::|.:|.......:|..||   ...:...|:.:||:.:......|:|||..||.||..::..::|
  Fly     3 TECRICGERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQR 67

  Fly    70 IQRVHNEATLRRESGLDEDLESTVS-DIEPEGDSSDLESEESYDSENYPFDKKAEESDIDLNLAH 133
            ....|  |.|.:.......:.|..| ::.|......|:.|...|:.:...||:..:.|.||    
  Fly    68 CLETH--ANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDL---- 126

  Fly   134 EDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYPS 198
               .::..:..:.|.|::   :.|..:.....::|.||:   :||:          :|       
  Fly   127 ---MDDDKDFLEDEKPIL---RYPPAKKIRIEDQNFPNR---QSPR----------VR------- 165

  Fly   199 IKVVKPLALAPEDVAAENVPPAKRTARK-------------MQSLVCPKCGRVFKTPYNLKTHMV 250
               ||.|.:...:.|....||.:...||             ::..||.:||..|....|:|.|.:
  Fly   166 ---VKRLRVPVVEKADSPPPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKL 227

  Fly   251 RHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLR 315
            ||..|| |.|..|.::|.|..|.|||.||.|.||:|:.|.||...|..|.::..|||..|..:|.
  Fly   228 RHFEEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELV 291

  Fly   316 YQCDQCTKRFNTKTCLNKHKFLHSGLKP--FDCVICQINFARKATLRSHFDSVAHQKRASAIL 376
            :.|..|.||||::....||:..|...:|  ..|:.|...|.....|..|:.:..|:||.:.::
  Fly   292 HPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 17/67 (25%)
zf-C2H2 231..252 CDD:278523 8/20 (40%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 11/24 (46%)
C2H2 Zn finger 260..281 CDD:275368 10/20 (50%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 20/73 (27%)
COG5048 <202..343 CDD:227381 52/141 (37%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
zf-H2C2_2 249..274 CDD:290200 13/24 (54%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 6/15 (40%)
zf-C2H2_jaz 322..347 CDD:288983 5/24 (21%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8018
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.