DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG4820

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:403 Identity:97/403 - (24%)
Similarity:162/403 - (40%) Gaps:94/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CASCFCHLNPTIIF--CLEV--------LAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLK 67
            |.:|    ..|::.  ||::        |..::.:|..||:..:..|.|||..|...|:...|.:
  Fly     5 CRTC----GKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFR 65

  Fly    68 KRIQRVHNEATLRRES------------------------GLDEDLESTVSDIEPEGDSSDLESE 108
            :|..::......||..                        |:||.:.::...|||    ..|:.|
  Fly    66 RRCAKIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEP----IQLQME 126

  Fly   109 ESYDSENYPFDKKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANE--NLPN 171
            |...:. ||      |:.::..|::.:.      |.:...||...:.....|..:..||  ...:
  Fly   127 EDPQAP-YP------ENQLEQALSYGNA------PGEDILPLPEDYGEAQTEVATTTNEPAQRRS 178

  Fly   172 KVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCG 236
            |..||...|.:.:::|..|      ..:||:..  ..|:.:...|.|.||       ..:|..||
  Fly   179 KNTAKIKSKKHTMRVGRKL------IHVKVIDD--KQPKRIVDRNGPSAK-------PCICEHCG 228

  Fly   237 RVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTA 301
            |.||...||..|::||||.|.|.|..|.::..|.:|.|.|: ::|. |.|:.|.||...:.|:::
  Fly   229 RQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQ-LKHT-EGPYACTFCGLEYSTNSS 291

  Fly   302 KSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSV 366
            :..|||           :.|.|   .:...:|.:.:..|.:.|.|.:|.:.|.|......|.:|.
  Fly   292 RVRHER-----------EACKK---GRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSS 342

  Fly   367 AH------QKRAS 373
            :|      :||.|
  Fly   343 SHIENERRKKRKS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 17/70 (24%)
zf-C2H2 231..252 CDD:278523 9/20 (45%)
C2H2 Zn finger 232..252 CDD:275368 9/19 (47%)
zf-H2C2_2 244..269 CDD:290200 11/24 (46%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 3/19 (16%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 17/73 (23%)
C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
C2H2 Zn finger 252..272 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.