DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and M1BP

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:438 Identity:109/438 - (24%)
Similarity:167/438 - (38%) Gaps:109/438 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQCHLCASCFCHLNPTIIF---CLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKR 69
            |.|.:||....:.....:|   ..:::..|:.|||:.||.....|..||..|..:|.:::||::|
  Fly    11 STCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRER 75

  Fly    70 IQRVHNEATL----RRESGL---------------------DEDLESTVSDI---EPEGDSSDLE 106
            ......|..|    .:..|:                     |:::.:|..:|   ||:.:..|.:
  Fly    76 CIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTK 140

  Fly   107 SEESYDSENYPF-------DKKA---EESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPL--- 158
            .|  ||:..|..       |..|   ||:|.|..:| ||...:.....|.:|.||....|..   
  Fly   141 VE--YDNTYYEVAEGHAGEDDAASLIEEADYDSIMA-EDEEQQQTLELDEDTELIVGDVNDAYVY 202

  Fly   159 -----------IETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDV 212
                       :....:.:||:                               |||..:|.|:  
  Fly   203 DSDDEVAVLDNVLDDEYEHENI-------------------------------VVKKCSLPPK-- 234

  Fly   213 AAENVPPAKRT--ARKMQS---LVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYL 272
                  |..|:  ||:..:   .:|.:||...|.....:.|..||.|:|.|.|..|..||.|...
  Fly   235 ------PKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSE 293

  Fly   273 ARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFL 337
            .:.|.| :|.||:||.|.:|...|...|.:..||| .|..:..|.|..|.|.|.|...|..|..:
  Fly   294 LKRHMR-KHTGERPFACKYCGRCFTDYTTRVKHER-THTNERPYVCGTCGKAFTTGYILKNHMLI 356

  Fly   338 HSGLKPFDCVICQINFARKATLRSHFDSVAHQK-----RASAILESEE 380
            |||.:.:.|.:|..:|.....|.:||.|..|::     ....:||.|:
  Fly   357 HSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVLEQEQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 18/67 (27%)
zf-C2H2 231..252 CDD:278523 5/20 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..281 CDD:275368 7/20 (35%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/70 (27%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 22/56 (39%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 293..317 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 7/20 (35%)
zf-H2C2_2 324..346 CDD:290200 9/22 (41%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 7/21 (33%)
C2H2 Zn finger 365..383 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.