DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and nom

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:366 Identity:89/366 - (24%)
Similarity:148/366 - (40%) Gaps:74/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRVHNEATLRRESGLDEDLESTV 93
            ::|.:|:.:|||.|:|....|..:|..|..||.:::             ..||:..|.:.....:
  Fly    28 DILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAM-------------IFRRQCILQQKKWVPL 79

  Fly    94 SDIEPEGDSSDLESEESYDSENYPFDKKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPL 158
            ...:..|     .|||.....|.|..||.         ..:.||..|..|.:....::..     
  Fly    80 LQSDKVG-----ASEEKKVEPNDPSTKKK---------TTKRRRGRPRMPLEIVDIVVTN----- 125

  Fly   159 IETPSFANEN-----------LPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPED- 211
             |:.:.|.|:           :.|:.||..          :|:.|          :.:.|..|| 
  Fly   126 -ESKASAGESVGGDEFDQPVEISNEPDATD----------SDVNL----------EEIDLPDEDG 169

  Fly   212 VAAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLH 276
            :.:::..|      .:|...|..||.:.....:|..|...|.|.:.:||..|.|.|:.....:.|
  Fly   170 LESDHDLP------NVQIHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAH 228

  Fly   277 ERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNK-HKFLHSG 340
            ....|..|.||.|.:|...:|:...:..|||: |..:..:.||||.|.| |:||:.| |..:|..
  Fly   229 NLTHHTLEPPFACRYCDRRYFSVVGRKKHERV-HTNERPFVCDQCGKAF-TRTCILKAHMAVHQV 291

  Fly   341 LKPFDCVICQINFARKATLRSHFDSVAHQKRASAILESEEH 381
            ::.:.|.:|..:|:.|..|.:||.|..|::.|.|:..|.|:
  Fly   292 VRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 12/44 (27%)
zf-C2H2 231..252 CDD:278523 5/20 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 9/24 (38%)
C2H2 Zn finger 260..281 CDD:275368 5/20 (25%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 11/20 (55%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 15/60 (25%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 15/49 (31%)
zf-H2C2_2 255..278 CDD:290200 10/24 (42%)
C2H2 Zn finger 269..289 CDD:275368 11/20 (55%)
zf-H2C2_2 282..305 CDD:290200 5/22 (23%)
C2H2 Zn finger 297..313 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.