DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG14667

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:402 Identity:85/402 - (21%)
Similarity:151/402 - (37%) Gaps:111/402 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CHLCA----------SCFCHLNPTIIFCLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSI 64
            |.:||          :.|.|:..      :.|.::|.:||:.|.:|:..|..:|..|.::|:.:.
  Fly     7 CRICANKIMGHQRDRNIFIHMRG------KYLGQLKLITGVELTRNQGLPEIVCERCFSELDLAT 65

  Fly    65 KLKKR-----------IQRVHNEATLRRE---SGLDEDLESTVSDIEPEGDSSDLESEESYDSEN 115
            |.::|           |::..:::|:..|   ..|||.|.          |:..||:.  ||.:.
  Fly    66 KFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLI----------DADQLETH--YDDDQ 118

  Fly   116 YPFDKKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKK 180
            |...:..:|.       |:|...                                          
  Fly   119 YVCYQGTKEE-------HQDLEE------------------------------------------ 134

  Fly   181 GNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENV--PPAKRTA-RKMQSLVCPKCGRVFKTP 242
               |::..|       ||..|:.....|.|....|::  ...:|.| |:....:|.:||.:|...
  Fly   135 ---IELDDD-------PSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDA 189

  Fly   243 YNLKTHMVRHTGEKN----FPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKS 303
            :....|:..|...::    |||..|.:.|..|.|.:.|....|:..:.|:|..|...|.:..||.
  Fly   190 FLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKL 254

  Fly   304 SHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHS-GLKPFDCVICQINFARKATLRSHFDSVA 367
            .|:: .|..:..|.|.:|...|::.:.|..|...|| .::.|.|..|.::|..:..|.:|..:..
  Fly   255 RHDK-AHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAP 318

  Fly   368 HQKRASAILESE 379
            | ||.:..::.|
  Fly   319 H-KRLAKYMQDE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 18/84 (21%)
zf-C2H2 231..252 CDD:278523 5/20 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 7/28 (25%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 17/78 (22%)
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 6/20 (30%)
zf-C2H2_8 243..313 CDD:292531 19/70 (27%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.