DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG17359

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:387 Identity:82/387 - (21%)
Similarity:140/387 - (36%) Gaps:122/387 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLA-KIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRVHN--EATLRRESGLDEDLES 91
            ||| .:::.:|..:.:.:..|:.||..|...:..:.:|:::.::.|.  |........|| |:|.
  Fly    37 VLATMLRECSGCSVHKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELD-DIEY 100

  Fly    92 TVS---DIEPEGDSSDLESEESYDSEN-----------YPFDKKAEESDIDLNLAHE-------- 134
            .::   :|||:...|.:|:.::.::..           .|.:.|...|.:..|..|:        
  Fly   101 CLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPA 165

  Fly   135 -------DRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAK---SPKKGNFIQIGTD 189
                   .||...::..||.:|                :..|.::.|.|   :.|:|        
  Fly   166 KTPHNKSKRRARSYSDNDSWSP----------------DSELEHEDDDKIWNASKRG-------- 206

  Fly   190 LRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHMVRHTG 254
                         ||          :.||...|         |..|.:.|....||:.||..|||
  Fly   207 -------------KP----------KRVPGPYR---------CKLCTQSFTQKQNLEIHMRIHTG 239

  Fly   255 EKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCD 319
            |:.:.|:.|.:.|..|...:.|.|. |.||:||                             .|.
  Fly   240 ERPYKCSLCPRSFAQKGNLQSHTRC-HTGERPF-----------------------------GCP 274

  Fly   320 QCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRASAILESEEH 381
            .|.|||.....|..|...|:|.:||.|..||.:|.:...|:.|..:....||.::..|::.:
  Fly   275 NCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQETKRN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 9/44 (20%)
zf-C2H2 231..252 CDD:278523 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 11/24 (46%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 0/18 (0%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 11/50 (22%)
zf-C2H2 215..237 CDD:278523 8/30 (27%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 6/20 (30%)
zf-H2C2_2 257..282 CDD:290200 12/54 (22%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.