DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and prg

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster


Alignment Length:407 Identity:105/407 - (25%)
Similarity:155/407 - (38%) Gaps:95/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQCHLCASCFCHLN----------PTIIFCLEV-LAKI-KDLTGIWLEQNERQPRHICPSCLNDL 60
            |.|.|     ||.|          .|:.||.:| :|:: |.|..:..::||.....||..||..|
  Fly    15 STCRL-----CHHNTDPNSLNIFDDTVQFCKDVSIAEVSKSLWSVQYDRNECLSELICSRCLEIL 74

  Fly    61 NTSIKLKKRIQRVHNEATLRRESGLDEDLESTVSD-------------------------IEPEG 100
            ..:.:|:|.:|        .||..|.|.|:..:.|                         ::||.
  Fly    75 EEAFELRKGMQ--------EREQSLQEQLKEMIKDHPKHRPGLNGNPGVFVPEEGCIIVEVDPEN 131

  Fly   101 DSSDLESEESYDS----ENYPFDKKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIET 161
            .:...|.|.:..|    |||..|.:.||.|.|     |:...:..|..|.:.||...... :...
  Fly   132 LAESSEEEFALGSDGEYENYDDDDEEEEEDYD-----EEDEEDGQNGEDVDMPLGMDAAQ-MAAQ 190

  Fly   162 PSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAE--NVPPAKRTA 224
            .|.||.  .|..:|: ||:.          .|..|..:....|......::||.  |.|      
  Fly   191 QSVANN--ANTTEAR-PKRA----------FLCQYCDLGFTLPAECQEHELAAHDPNAP------ 236

  Fly   225 RKMQSLVCPKCGRVFKTPYNLKTHM-VRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFE 288
                 ..|..|.....|...|.:|: ..|..::.:.|..|.|.||.:...:.|..| |.|.:||.
  Fly   237 -----YCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIV-HTGVRPFT 295

  Fly   289 CNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINF 353
            ||.||.:|..:|..:.|.|| |.....:.|.||.:.|.|...:.:|...|..:|.|.|..|..:|
  Fly   296 CNVCSKSFSRNTNLTKHMRI-HSGVKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAFQCGRCPYSF 359

  Fly   354 ARKATLRSHFDSVAHQK 370
            :|:..|      :|||:
  Fly   360 SRRDKL------IAHQQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 22/76 (29%)
zf-C2H2 231..252 CDD:278523 5/21 (24%)
C2H2 Zn finger 232..252 CDD:275368 5/20 (25%)
zf-H2C2_2 244..269 CDD:290200 7/25 (28%)
C2H2 Zn finger 260..281 CDD:275368 7/20 (35%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
prgNP_001260253.1 zf-AD 16..94 CDD:285071 25/90 (28%)
COG5048 <212..340 CDD:227381 38/140 (27%)
C2H2 Zn finger 239..260 CDD:275368 5/20 (25%)
C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
zf-H2C2_2 280..305 CDD:290200 11/25 (44%)
zf-C2H2 294..316 CDD:278523 10/22 (45%)
C2H2 Zn finger 296..316 CDD:275368 9/20 (45%)
zf-H2C2_2 308..331 CDD:290200 7/23 (30%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..372 CDD:275368 8/25 (32%)
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 443..464 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.