DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG31441

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:392 Identity:102/392 - (26%)
Similarity:169/392 - (43%) Gaps:73/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEMKKPSQCHLCASCFCHL--NPTIIF---CLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDL 60
            |.|::  |.|..|.....:|  ..|.:|   ....::.::::|.::||.:...|..||..|...|
  Fly     1 MSELR--SICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQL 63

  Fly    61 NTSIKLKKRIQRVH------NEATLRRESGLDEDLESTVSDIEPEGDSSDLE--SEESYDSENYP 117
            :..:..:.:...||      |...||:::.:||:|           |..|:|  .::.:|     
  Fly    64 DRILTFRNKCLEVHKSFMAANRKLLRKKAIVDEEL-----------DKPDVEKLQQDLWD----- 112

  Fly   118 FDKKAEESDIDLNLAHEDRR---NEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPK 179
                  .:|.::.:|..|..   .|.||.                      ||...:..||...:
  Fly   113 ------HTDQEMCVAMADTAGLLREDHND----------------------NEKAKDAEDATQNE 149

  Fly   180 KG--NFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFKTP 242
            |.  ..:|:.|:    ......:.:..:::..:.|:| .||  |||.|..:|..|.:||.|||:.
  Fly   150 KNQEEQVQVQTE----EVEHCQEQLHNMSIISKGVSA-RVP--KRTKRNSKSWFCDQCGGVFKSS 207

  Fly   243 YNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHER 307
            ..||.|:.||:|.|.|.|..|..::.|....|.| |:.|...:|:.|.|||.|:...::|..|||
  Fly   208 TYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRH-RILHTDARPYACRFCSKTYRGCSSKVVHER 271

  Fly   308 IRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRA 372
             .|..:..:||..|.|.|.:.:...||:.||:..:.:.|.||...|.|.:.|..|..:..||:||
  Fly   272 -THTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLHQRRA 335

  Fly   373 SA 374
            .:
  Fly   336 ES 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 13/69 (19%)
zf-C2H2 231..252 CDD:278523 9/20 (45%)
C2H2 Zn finger 232..252 CDD:275368 9/19 (47%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 8/18 (44%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
C2H2 Zn finger 346..362 CDD:275368 6/15 (40%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 15/74 (20%)
COG5048 <174..337 CDD:227381 61/167 (37%)
C2H2 Zn finger 197..217 CDD:275370 9/19 (47%)
C2H2 Zn finger 225..245 CDD:275368 6/20 (30%)
C2H2 Zn finger 253..273 CDD:275368 9/20 (45%)
zf-H2C2_2 268..290 CDD:290200 9/22 (41%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.