DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and CG10959

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:385 Identity:90/385 - (23%)
Similarity:143/385 - (37%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EVLAKIKDL-TGIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRVHNEATLRRESGLDEDLEST 92
            :||::.:|. ..:.|||:|..|..|                        ..|..:..:||:...|
  Fly   108 DVLSEEEDAEQELGLEQDEGNPLRI------------------------MVLGGKQSVDEETIDT 148

  Fly    93 VSDIEPEGDSSDLESEES---------YDSENYPFDKKAEESDIDLNLAHEDRRNEPHNPYDSET 148
            :  .:|:.|||.....|.         .:.::|..|:..||        |:....:...|.|...
  Fly   149 M--WQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEE--------HQSVFKKQRQPKDYNC 203

  Fly   149 PLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYP-SIKVVKPLALAPEDV 212
            |    |.:....|..:.|                     |.|::...:| :.|.|...|....|.
  Fly   204 P----HCDRRYTTQKYLN---------------------THLKMSHPFPQAFKCVDCKATFDVDR 243

  Fly   213 AAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTF--CDKRFVTKYLARL 275
            |.     |:...::.....|..|.:|||:..:|..|:..|:|.:.|.|..  |.|.||.::....
  Fly   244 AL-----AQHRRKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTS 303

  Fly   276 HERVR---------------------------HMGEQPFECNFCSATFFTSTAKSSHERIRHIRD 313
            |.||.                           |.||:||:|..|:..|.:.:..:.|:.: |..:
  Fly   304 HRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAM-HSTE 367

  Fly   314 LRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRAS 373
            ..|:||:|...|:....|..||.||.|:|.|.|.||...:|:.|.|.:|..  ||:.:||
  Fly   368 KPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHMR--AHKLQAS 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 9/45 (20%)
zf-C2H2 231..252 CDD:278523 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 9/26 (35%)
C2H2 Zn finger 260..281 CDD:275368 8/49 (16%)
C2H2 Zn finger 289..308 CDD:275368 4/18 (22%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 6/15 (40%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 5/25 (20%)
COG5048 <258..416 CDD:227381 47/158 (30%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 0/19 (0%)
zf-H2C2_2 328..353 CDD:290200 8/24 (33%)
C2H2 Zn finger 344..364 CDD:275368 4/20 (20%)
zf-H2C2_2 357..381 CDD:290200 7/24 (29%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
C2H2 Zn finger 400..420 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.