DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17801 and unc-98

DIOPT Version :9

Sequence 1:	NP_650660.2	Gene:	CG17801 / 42144	FlyBaseID:	FBgn0038550	Length:	381	Species:	Drosophila melanogaster
Sequence 2:	NP_509284.2	Gene:	unc-98 / 181020	WormBaseID:	WBGene00006827	Length:	310	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	36/143 - (25%)
Similarity:	55/143 - (38%)	Gaps:	31/143 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   228 QSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRF--VTKYLARLH-------------- 276
            |..||.|||..|:....|:.|..:|:....:.|. |.:.|  .|:.|...|
Worm   139 QPYVCGKCGDSFEFACQLEYHAAQHSEIDGYKCE-CGRTFFSYTEMLYHKHTDDPLELIGAPETT 202

  Fly   277 ------ERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLR---YQCDQCTKRFNTKTCLN 332
                  :||..:.||    :.....|.|...:..|. :|...|:|   |.|:.|:|.::....|.
Worm   203 TIKVSKKRVLPVSEQ----DLPQPAFVTEGYEPKHP-LRVYNDVRSKPYICEYCSKSYSDSRGLA 262

  Fly   333 KHKFLHSGLKPFD 345
            .|.:.|.|.|.|:
Worm   263 YHMYSHRGEKYFN 275

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17801	NP_650660.2	zf-AD	9..74	CDD:285071
		zf-C2H2	231..252	CDD:278523	8/20 (40%)
		C2H2 Zn finger	232..252	CDD:275368	7/19 (37%)
		zf-H2C2_2	244..269	CDD:290200	6/26 (23%)
		C2H2 Zn finger	260..281	CDD:275368	8/42 (19%)
		C2H2 Zn finger	289..308	CDD:275368	3/18 (17%)
		C2H2 Zn finger	318..338	CDD:275368	5/19 (26%)
		C2H2 Zn finger	346..362	CDD:275368	36/143 (25%)
unc-98	NP_509284.2	C2H2 Zn finger	115..135	CDD:275368
		C2H2 Zn finger	143..163	CDD:275368	7/19 (37%)
		SFP1	<169..268	CDD:227516	22/104 (21%)
		C2H2 Zn finger	171..189	CDD:275368	5/18 (28%)
		C2H2 Zn finger	248..268	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000