Sequence 1: | NP_650660.2 | Gene: | CG17801 / 42144 | FlyBaseID: | FBgn0038550 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023313.1 | Gene: | M03D4.4 / 177375 | WormBaseID: | WBGene00019751 | Length: | 505 | Species: | Caenorhabditis elegans |
Alignment Length: | 243 | Identity: | 61/243 - (25%) |
---|---|---|---|
Similarity: | 92/243 - (37%) | Gaps: | 49/243 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 KKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFI 184
Fly 185 QIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHM 249
Fly 250 VRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDL 314
Fly 315 RYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSH 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17801 | NP_650660.2 | zf-AD | 9..74 | CDD:285071 | |
zf-C2H2 | 231..252 | CDD:278523 | 7/20 (35%) | ||
C2H2 Zn finger | 232..252 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 244..269 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 260..281 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 346..362 | CDD:275368 | 4/15 (27%) | ||
M03D4.4 | NP_001023313.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 102..127 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 146..166 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 158..181 | CDD:290200 | 7/23 (30%) | ||
zf-C2H2 | 172..194 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 9/19 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |