DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17801 and M03D4.4

DIOPT Version :9

Sequence 1:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:243 Identity:61/243 - (25%)
Similarity:92/243 - (37%) Gaps:49/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KKAEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFI 184
            ::.|...::.....|||..:     ||:...:.|.|   ||...|.::                 
 Worm    24 EREEHETVEQGDQEEDRMED-----DSDELAMIKIK---IEDSDFLSD----------------- 63

  Fly   185 QIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHM 249
               ||...|:..|:                  .|..|.::.:.....|..|..:|.....|.|||
 Worm    64 ---TDSSQLSMNPT------------------TPSEKSSSGEKGRYECEDCHEMFAVKRELATHM 107

  Fly   250 VRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDL 314
            ..|:||:...||.|.|.|.|:.|.:.| .:.|.||:...|..|:..||.....:.|..| |....
 Worm   108 RIHSGEQPHSCTQCGKEFGTRQLLKKH-WMWHTGERSHVCPHCNKAFFQKGHLTQHLMI-HSGGR 170

  Fly   315 RYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSH 362
            .::|.||.|.|..|..||:|..:|.. :.|.|..|..:|.::..|..|
 Worm   171 PHECPQCHKTFIFKFDLNRHMKIHQE-RGFSCQQCGRSFLKQVMLDEH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17801NP_650660.2 zf-AD 9..74 CDD:285071
zf-C2H2 231..252 CDD:278523 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 12/24 (50%)
C2H2 Zn finger 260..281 CDD:275368 8/20 (40%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 9/19 (47%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 7/19 (37%)
zf-H2C2_2 102..127 CDD:290200 12/24 (50%)
C2H2 Zn finger 118..138 CDD:275368 8/20 (40%)
C2H2 Zn finger 146..166 CDD:275368 6/20 (30%)
zf-H2C2_2 158..181 CDD:290200 7/23 (30%)
zf-C2H2 172..194 CDD:278523 9/21 (43%)
C2H2 Zn finger 174..194 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.