DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN12

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001156863.1 Gene:ZSCAN12 / 9753 HGNCID:13172 Length:611 Species:Homo sapiens


Alignment Length:423 Identity:101/423 - (23%)
Similarity:170/423 - (40%) Gaps:92/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FRQACIKTNNRLTIQRRSVEAKDDGC--WADPLSDAHEGLKINDAEVEQEVLYEVSYADNEGLEE 125
            |||.|.:..:.   .|.::....:.|  |..|  :.|...:|.:..|.::.|..:.......::|
Human    49 FRQFCYQETSG---PREALSRLRELCHQWLRP--ETHTKEQILELLVLEQFLTILPEELQAWVQE 108

  Fly   126 DH------------DLYKKEEEESE----------------VNENKEFEDIACEIPFSK-----E 157
            .|            ||.::.:|..|                |...||.|. :..:...|     |
Human   109 QHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEP-SMSLQSMKAQPKYE 172

  Fly   158 DDEQEQQQEYEDMVDKKTGHDDGEESQE-CEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDS 221
            ..|.|.||  |.::|.:||::.|...|| .||.:|..:.|.:.|.|..:|.         ..|::
Human   173 SPELESQQ--EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSA---------RCGET 226

  Fly   222 DTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCG 286
            ....:...:..|.||     |||:|.......|..:|.|      ..:.::....::.:.||.||
Human   227 REPEEITEEPSACSR-----EDKQPTCDENGVSLTENSD------HTEHQRICPGEESYGCDDCG 280

  Fly   287 KKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTM 351
            |.|:...:...|...|:|.:|::|.|||:....|.:|..| ::.|.|||||.|..|.:.|...:.
Human   281 KAFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRH-KIIHTGEKPYKCNECGKAFGRWSA 344

  Fly   352 RSRHENRVHRNKK-------------------------TPKNFKCNYCDKRYESNYQRAKHEVVH 391
            .::|: |:|..:|                         ..|.::|..|:|.:.......:|:.||
Human   345 LNQHQ-RLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVH 408

  Fly   392 TGERNFHCEVCKVSFTRNSNLKTHYRSRQHQNK 424
            ||.:.:.|..|..:|..||:|.:| :...|:.|
Human   409 TGAKPYECNECGKAFVYNSSLVSH-QEIHHKEK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 4/10 (40%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 7/22 (32%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZSCAN12NP_001156863.1 SCAN 42..152 CDD:128708 19/107 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..175 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..264 19/85 (22%)
C2H2 Zn finger 248..268 CDD:275368 3/25 (12%)
C2H2 Zn finger 276..296 CDD:275368 7/19 (37%)
COG5048 299..579 CDD:227381 39/145 (27%)
C2H2 Zn finger 304..324 CDD:275368 7/20 (35%)
C2H2 Zn finger 332..352 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..380 CDD:275368 0/19 (0%)
C2H2 Zn finger 388..408 CDD:275368 4/19 (21%)
C2H2 Zn finger 416..436 CDD:275368 7/20 (35%)
C2H2 Zn finger 444..463 CDD:275368
C2H2 Zn finger 471..491 CDD:275368
C2H2 Zn finger 499..519 CDD:275368
C2H2 Zn finger 527..547 CDD:275368
C2H2 Zn finger 555..575 CDD:275368
C2H2 Zn finger 583..603 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.