DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF101

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_149981.2 Gene:ZNF101 / 94039 HGNCID:12881 Length:436 Species:Homo sapiens


Alignment Length:170 Identity:54/170 - (31%)
Similarity:81/170 - (47%) Gaps:21/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 KPAKKKR--KTYIS--------------QKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPEC 313
            ||.|.|:  |.:||              :|.|.|..||||.:...:.:.|...|||.|.:||.:|
Human   251 KPYKCKQCGKAFISAGYLRTHEIRSHALEKSHQCQECGKKLSCSSSLHRHERTHSGGKLYECQKC 315

  Fly   314 GQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRY 378
            .:.......|..|.|. |.||:||.|..|.:.|.:.:...||: :.|..:|.   ::|..|.|.:
Human   316 AKVFRCPTSLQAHERA-HTGERPYECNKCGKTFNYPSCFRRHK-KTHSGEKP---YECTRCGKAF 375

  Fly   379 ESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRS 418
            .......:||:.||||:.|.|:.|...||.::.|:.|.|:
Human   376 GWCSSLRRHEMTHTGEKPFDCKQCGKVFTFSNYLRLHERT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 7/21 (33%)
C2H2 Zn finger 399..417 CDD:275368 6/17 (35%)
ZNF101NP_149981.2 KRAB 4..>46 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 104..124 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..164
lambda-1 149..>209 CDD:212564
C2H2 Zn finger 171..191 CDD:275368
COG5048 <176..357 CDD:227381 34/106 (32%)
C2H2 Zn finger 199..219 CDD:275368
C2H2 Zn finger 227..247 CDD:275368
zf-H2C2_2 240..264 CDD:290200 5/12 (42%)
C2H2 Zn finger 255..276 CDD:275368 4/20 (20%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
C2H2 Zn finger 312..332 CDD:275368 5/20 (25%)
zf-H2C2_2 324..349 CDD:290200 11/25 (44%)
COG5048 336..>407 CDD:227381 23/74 (31%)
C2H2 Zn finger 340..360 CDD:275368 5/20 (25%)
zf-H2C2_2 353..375 CDD:290200 7/25 (28%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
zf-H2C2_2 380..404 CDD:290200 9/23 (39%)
C2H2 Zn finger 396..416 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.