DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF496

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_116141.1 Gene:ZNF496 / 84838 HGNCID:23713 Length:587 Species:Homo sapiens


Alignment Length:471 Identity:110/471 - (23%)
Similarity:172/471 - (36%) Gaps:110/471 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PQCRLCGDLIYTQNPVNIFDENSKMVRQIALVTGLWLTDHSKMP-RNMCSCCLLSLKSAIAFRQA 66
            |..:|.||.: .|:...:.:||   ||....||.|.|......| ::|..|.             
Human   183 PPSQLSGDPV-LQDAFLLQEEN---VRDTQQVTTLQLPPSRVSPFKDMILCF------------- 230

  Fly    67 CIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLKINDAEVEQEVLYEVSYADNEGLEEDHDLYK 131
                            :::|....||......|..|...:      |.||...|: |....||.:
Human   231 ----------------SEEDWSLLDPAQTGFYGEFIIGED------YGVSMPPND-LAAQPDLSQ 272

  Fly   132 KEEEESEVNENKEFEDIACEIP-FSKEDDEQEQQQEYEDMVDKKTGHDDGEESQECEESQPDEE- 194
            .||.|..|.|.::.:  ..|:| .|..|....|..:.|:.  :|.......|.|.|.::...:. 
Human   273 GEENEPRVPELQDLQ--GKEVPQVSYLDSPSLQPFQVEER--RKREELQVPEFQACPQTVVPQNT 333

  Fly   195 -------ESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTK 252
                   .|.:|..|||.:    .|:..:..||.|:........|..|          |..|  :
Human   334 YPAGGNPRSLENSLDEEVT----IEIVLSSSGDEDSQHGPYCTEELGS----------PTEK--Q 382

  Fly   253 RSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHV-LRHSGVKPFECPECGQK 316
            ||.|.:..:.    .:...:...|:|.::|.:|||.|..:.||..|: .|....||.||..||:.
Human   383 RSLPASHRSS----TEAGGEVQTSKKSYVCPNCGKIFRWRVNFIRHLRSRREQEKPHECSVCGEL 443

  Fly   317 EFNRYILNIHIRVKHRGEKPYACQFCDERF-VHSTMRSRHENRVH-------------------- 360
            ..:...|:.|:. .|..:|||.|..|.:.| ::|.:.|  ..|:|                    
Human   444 FSDSEDLDGHLE-SHEAQKPYRCGACGKSFRLNSHLLS--HRRIHLQPDRLQPVEKREQAASEDA 505

  Fly   361 --------RNKKTPKNFKCNYCDKRYESNYQRAKHEV-VHTGE--RNFHCEVCKVSFTRNSNLKT 414
                    .|.|...:|:|..|.|.::.:...|:|.. .|..:  |.|.|..|..|||:|.:|..
Human   506 DKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLR 570

  Fly   415 HYRSRQHQNKLIAMSA 430
            |.|....:....|:::
Human   571 HERLHMKRRSKQALNS 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 15/70 (21%)
C2H2 Zn finger 282..302 CDD:275368 8/20 (40%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 9/22 (41%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF496NP_116141.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
SCAN 50..126 CDD:280241
KRAB_A-box 222..259 CDD:143639 10/71 (14%)
KRAB 223..275 CDD:214630 14/87 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 8/22 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..399 10/56 (18%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
COG5048 <427..>586 CDD:227381 41/161 (25%)
C2H2 Zn finger 437..457 CDD:275368 5/20 (25%)
zf-C2H2 463..485 CDD:278523 7/23 (30%)
C2H2 Zn finger 465..485 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513 0/24 (0%)
zf-C2H2 522..543 CDD:278523 6/20 (30%)
C2H2 Zn finger 524..543 CDD:275368 5/18 (28%)
zf-C2H2 553..575 CDD:278523 10/21 (48%)
C2H2 Zn finger 555..575 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.