DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF397

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006722621.1 Gene:ZNF397 / 84307 HGNCID:18818 Length:553 Species:Homo sapiens


Alignment Length:346 Identity:79/346 - (22%)
Similarity:144/346 - (41%) Gaps:95/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FEDIACEIPFSKEDDE------QEQQQEYEDMVDKKTGHDDGEESQECEESQPDEEESQ---QNE 200
            ::|:.| :..|:|..:      :.|.:.::..:..|:   |.|.|:...:....||:||   |..
Human   169 WKDLTC-LRASQESTDIHLQPLKTQLKSWKPCLSPKS---DCENSETATKEGISEEKSQGLPQEP 229

  Fly   201 EDEEESQEDDDELWQ-----NEDGDSDTDADSMSDI----EATSRQSALDE-------------- 242
            .....|:.:.:.:|:     .|...|.:...|.|.:    ::..::...||              
Human   230 SFRGISEHESNLVWKQGSATGEKLRSPSQGGSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMC 294

  Fly   243 -----DKKPRR------KYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFN 296
                 :::|.|      .:.:.||           ..:.::.:..:|.:.|:.|||.|:.:....
Human   295 QKVPPEERPYRCDVCGHSFKQHSS-----------LTQHQRIHTGEKPYKCNQCGKAFSLRSYLI 348

  Fly   297 LHVLRHSGVKPFECPECGQKEFNR------------------------------YILNIHIRVKH 331
            :|...|||.|.:||.||| |.||:                              |:: ||.|: |
Human   349 IHQRIHSGEKAYECSECG-KAFNQSSALIRHRKIHTGEKACKCNECGKAFSQSSYLI-IHQRI-H 410

  Fly   332 RGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERN 396
            .|||||.|..|.:.|..|:...||: |:|..::.   ::||.|.|.:..:.:...|:.:|:||:.
Human   411 TGEKPYECNECGKTFSQSSKLIRHQ-RIHTGERP---YECNECGKAFRQSSELITHQRIHSGEKP 471

  Fly   397 FHCEVCKVSFTRNSNLKTHYR 417
            :.|..|..:|:.:|||..|.|
Human   472 YECSECGKAFSLSSNLIRHQR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 11/50 (22%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 8/20 (40%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZNF397XP_006722621.1 SCAN 46..139 CDD:128708
SCAN 46..134 CDD:280241
COG5048 <297..546 CDD:227381 57/214 (27%)
zf-C2H2 304..326 CDD:278523 3/32 (9%)
C2H2 Zn finger 306..326 CDD:275368 2/30 (7%)
zf-H2C2_2 318..342 CDD:290200 6/34 (18%)
C2H2 Zn finger 334..354 CDD:275368 6/19 (32%)
zf-H2C2_2 346..371 CDD:290200 12/25 (48%)
C2H2 Zn finger 362..382 CDD:275368 7/20 (35%)
zf-H2C2_2 374..399 CDD:290200 0/24 (0%)
C2H2 Zn finger 390..410 CDD:275368 4/21 (19%)
zf-H2C2_2 402..427 CDD:290200 13/26 (50%)
C2H2 Zn finger 418..438 CDD:275368 7/20 (35%)
zf-H2C2_2 431..455 CDD:290200 8/27 (30%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 458..482 CDD:290200 6/23 (26%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
zf-H2C2_2 486..511 CDD:290200 4/7 (57%)
C2H2 Zn finger 502..522 CDD:275368
zf-C2H2 528..550 CDD:278523
C2H2 Zn finger 530..550 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.