Sequence 1: | NP_650659.2 | Gene: | CG17802 / 42143 | FlyBaseID: | FBgn0038549 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006722621.1 | Gene: | ZNF397 / 84307 | HGNCID: | 18818 | Length: | 553 | Species: | Homo sapiens |
Alignment Length: | 346 | Identity: | 79/346 - (22%) |
---|---|---|---|
Similarity: | 144/346 - (41%) | Gaps: | 95/346 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 FEDIACEIPFSKEDDE------QEQQQEYEDMVDKKTGHDDGEESQECEESQPDEEESQ---QNE 200
Fly 201 EDEEESQEDDDELWQ-----NEDGDSDTDADSMSDI----EATSRQSALDE-------------- 242
Fly 243 -----DKKPRR------KYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFN 296
Fly 297 LHVLRHSGVKPFECPECGQKEFNR------------------------------YILNIHIRVKH 331
Fly 332 RGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERN 396
Fly 397 FHCEVCKVSFTRNSNLKTHYR 417 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17802 | NP_650659.2 | zf-AD | 4..74 | CDD:285071 | |
C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 310..331 | CDD:275368 | 11/50 (22%) | ||
C2H2 Zn finger | 339..360 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 371..388 | CDD:275370 | 4/16 (25%) | ||
zf-met | 398..421 | CDD:289631 | 8/20 (40%) | ||
C2H2 Zn finger | 399..417 | CDD:275368 | 7/17 (41%) | ||
ZNF397 | XP_006722621.1 | SCAN | 46..139 | CDD:128708 | |
SCAN | 46..134 | CDD:280241 | |||
COG5048 | <297..546 | CDD:227381 | 57/214 (27%) | ||
zf-C2H2 | 304..326 | CDD:278523 | 3/32 (9%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 2/30 (7%) | ||
zf-H2C2_2 | 318..342 | CDD:290200 | 6/34 (18%) | ||
C2H2 Zn finger | 334..354 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 346..371 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 362..382 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 374..399 | CDD:290200 | 0/24 (0%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 4/21 (19%) | ||
zf-H2C2_2 | 402..427 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 431..455 | CDD:290200 | 8/27 (30%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 458..482 | CDD:290200 | 6/23 (26%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 486..511 | CDD:290200 | 4/7 (57%) | ||
C2H2 Zn finger | 502..522 | CDD:275368 | |||
zf-C2H2 | 528..550 | CDD:278523 | |||
C2H2 Zn finger | 530..550 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |