DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and TT1

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:371 Identity:69/371 - (18%)
Similarity:110/371 - (29%) Gaps:155/371 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VEQEVLYEVSYADNEGLEEDH----DLYKKEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEY 167
            :|...|||:|.:.:......|    ||:....:.|.:| |...|    .:|..            
plant     1 MESPPLYEISSSSSSEKPRHHFQSLDLFPNLNQNSCIN-NTLIE----PLPLI------------ 48

  Fly   168 EDMVDKKTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIE 232
             |.::..:..|          ..|:...:::.|::|||.:|:|.|:          |.|....:.
plant    49 -DRINLNSNLD----------LNPNPLYAEEGEQEEEEEEEEDREV----------DVDLHIGLP 92

  Fly   233 ATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTY---------ISQKVH-------- 280
            ...:                   |.||.....|...|:..||         :|.|.:        
plant    93 GFGK-------------------PSNDAKQLKKRNGKEIATYDAGKGIENELSGKAYWIPAPEQI 138

  Fly   281 -------ICDHCGKKFTDKGNFNLHVLRHS-------------------GVKPFECPE-CGQ--- 315
                   .|..|.|.|....|..:|:..|.                   |:..:.|.| |..   
plant   139 LIGFTHFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCRNHID 203

  Fly   316 -------KEFNRYILNIHIRVKHRGEKPYACQFCDERF-VHSTMRSRHENRVHRNKKTPKNFKCN 372
                   |:|.  .|..|.:.|| |.||::|:.|.:.. |....|:..:|               
plant   204 HPRSKPLKDFR--TLQTHYKRKH-GHKPFSCRLCGKLLAVKGDWRTHEKN--------------- 250

  Fly   373 YCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRS 418
             |.||:.                   | ||...|....:||.|.::
plant   251 -CGKRWV-------------------C-VCGSDFKHKRSLKDHVKA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 7/31 (23%)
C2H2 Zn finger 339..360 CDD:275368 5/21 (24%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 7/21 (33%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
C2H2 Zn finger 257..274 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.