DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZKSCAN3

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001229823.1 Gene:ZKSCAN3 / 80317 HGNCID:13853 Length:538 Species:Homo sapiens


Alignment Length:456 Identity:106/456 - (23%)
Similarity:164/456 - (35%) Gaps:147/456 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CCLLSLKSAIAFRQACIKTNNRLTIQRRSVEAKDDGCWADPLSD--------AHEGLKINDAEVE 108
            ||.::|.:.....|:.       ..|......|.:...:.||.|        ||.|....|..|.
Human   146 CCKMALLTPAPGSQSS-------QFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVA 203

  Fly   109 QEVLYEVSYADNEGLEEDHDLYKKEEEESEVNENKEFEDIACEI--PFSKEDDEQ------EQQQ 165
            ..:..|     ::||                   .:.||:|..:  .::::|..|      |:|:
Human   204 SRLTPE-----SQGL-------------------LKVEDVALTLTPEWTQQDSSQGNLCRDEKQE 244

  Fly   166 EYEDMVDKKTGHDDGEESQECEESQPDEEESQQNEEDE---------------EESQEDDDELWQ 215
            .:..:|..      |:|.|......|..||..:.|..:               .|:.|.:..|.:
Human   245 NHGSLVSL------GDEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQEGRLQR 303

  Fly   216 -------------NEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKP- 266
                         :|.|.|...:..:|               |.||.:|..           || 
Human   304 KQKNATGGRRHICHECGKSFAQSSGLS---------------KHRRIHTGE-----------KPY 342

  Fly   267 -AKKKRKTYIS-------QKVHI------CDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKE 317
             .::..|.:|.       |:||.      |:.|||.|:...:...|...|:|.||:||.:||:..
Human   343 ECEECGKAFIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTF 407

  Fly   318 FNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH---------------------- 360
            .....|..|.|: |.|||||.|..|.:.|..|:...||: |:|                      
Human   408 SQSCSLLEHHRI-HTGEKPYQCSMCGKAFRRSSHLLRHQ-RIHTGDKNVQEPEQGEAWKSRMESQ 470

  Fly   361 -RNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQNK 424
             .|.:||.::|||.|::.:..|....:|:.:||||:.:.|..|...|||.|.|..|.||...:|.
Human   471 LENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNI 535

  Fly   425 L 425
            |
Human   536 L 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 4/21 (19%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 6/20 (30%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 10/22 (45%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZKSCAN3NP_001229823.1 SCAN 42..154 CDD:128708 3/7 (43%)
SCAN 42..130 CDD:280241
KRAB 214..274 CDD:214630 14/65 (22%)
KRAB 217..252 CDD:279668 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..274 11/53 (21%)
zf-C2H2 314..336 CDD:278523 7/36 (19%)
C2H2 Zn finger 316..336 CDD:275368 7/34 (21%)
zf-H2C2_2 329..351 CDD:290200 8/47 (17%)
C2H2 Zn finger 344..364 CDD:275368 3/19 (16%)
zf-H2C2_2 356..381 CDD:290200 8/24 (33%)
COG5048 <368..515 CDD:227381 46/148 (31%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
zf-H2C2_2 384..409 CDD:290200 9/24 (38%)
C2H2 Zn finger 400..420 CDD:275368 6/20 (30%)
zf-H2C2_2 412..437 CDD:290200 12/25 (48%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
zf-C2H2 480..502 CDD:278523 6/21 (29%)
C2H2 Zn finger 482..502 CDD:275368 5/19 (26%)
zf-H2C2_2 495..519 CDD:290200 8/23 (35%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.