DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF669

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_079080.2 Gene:ZNF669 / 79862 HGNCID:25736 Length:464 Species:Homo sapiens


Alignment Length:377 Identity:92/377 - (24%)
Similarity:147/377 - (38%) Gaps:106/377 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 KEEEESEVNENKEFEDIACEIPFSKED---DEQEQQQEYEDMVDKKTGHDDGEESQECEE-SQPD 192
            :|...|.:.::..|||:|  :.|::|:   .:..|:..|.:::           .:.|.. :...
Human    79 REPLASPIQDSVAFEDVA--VNFTQEEWALLDSSQKNLYREVM-----------QETCRNLASVG 130

  Fly   193 EEESQQNEEDEEESQEDD--DELWQ-----NEDGDSDTDADSMSDIEATS--------------- 235
            .:...||.||..|....|  :.:.|     .|||........:.:::...               
Human   131 SQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNENISTGLKPCECSICG 195

  Fly   236 ----RQSALD------EDKKP---------------------RRKYTKRS-SPKNDDT------D 262
                |.|.|:      ...||                     ||.....| :|....|      .
Human   196 KVFVRHSLLNRHILAHSGYKPYGEKQYKCEQCGKFFVSVPGVRRHMIMHSGNPAYKCTICGKAFY 260

  Fly   263 FLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNI-- 325
            ||...::.::|:..:|.:.|..|||.||..|:..:|...|:|.||:||.||| |.| |:..:.  
Human   261 FLNSVERHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTHTGEKPYECKECG-KTF-RFSCSFKT 323

  Fly   326 HIRVKHRGEKPYACQFCDERFVHSTMRSRHE------------------NRV-----HRNKKT-P 366
            |.|. |.||:||.|..||:.|..||....|.                  :|:     ||:..| .
Human   324 HERT-HTGERPYKCTKCDKAFSCSTSLRYHGSIHTGERPYECKQCGKAFSRLSSLCNHRSTHTGE 387

  Fly   367 KNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRS 418
            |.::|..||:.:........||.:||||:.:.|:.|..::||:|:|..|.||
Human   388 KPYECKQCDQAFSRLSSLHLHERIHTGEKPYECKKCGKAYTRSSHLTRHERS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
C2H2 Zn finger 310..331 CDD:275368 9/22 (41%)
C2H2 Zn finger 339..360 CDD:275368 8/43 (19%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 9/21 (43%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZNF669NP_079080.2 KRAB 90..>132 CDD:214630 9/54 (17%)
KRAB 90..129 CDD:279668 9/51 (18%)
C2H2 Zn finger 167..183 CDD:275368 0/15 (0%)
COG5048 <178..436 CDD:227381 68/260 (26%)
C2H2 Zn finger 191..211 CDD:275368 3/19 (16%)
C2H2 Zn finger 252..272 CDD:275368 3/19 (16%)
zf-H2C2_2 264..288 CDD:290200 6/23 (26%)
C2H2 Zn finger 280..300 CDD:275368 8/19 (42%)
zf-H2C2_2 296..315 CDD:290200 11/19 (58%)
C2H2 Zn finger 308..328 CDD:275368 9/22 (41%)
zf-H2C2_2 320..345 CDD:290200 11/25 (44%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 1/24 (4%)
C2H2 Zn finger 364..384 CDD:275368 3/19 (16%)
zf-H2C2_2 379..401 CDD:290200 7/21 (33%)
C2H2 Zn finger 392..412 CDD:275368 5/19 (26%)
zf-H2C2_2 408..429 CDD:290200 8/20 (40%)
C2H2 Zn finger 420..440 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.