DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF213

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001128127.1 Gene:ZNF213 / 7760 HGNCID:13005 Length:459 Species:Homo sapiens


Alignment Length:204 Identity:61/204 - (29%)
Similarity:92/204 - (45%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GDSDTDAD-SMSDIEATSRQSALDEDKKPRRKY-----TKRSSPKNDDTDFLKPAKKKR-KTYIS 276
            |.:.:|.. |.|..||    .|.:.:.:||...     .:|..|         |.:::: :...:
Human   262 GQTGSDVTVSWSPEEA----EAWESENRPRAALGPVVGARRGRP---------PTRRRQFRDLAA 313

  Fly   277 QKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQF 341
            :|.|.|..|||:|....:...|...|:|.||.:|||| .|.|......:..:..|.||||::|..
Human   314 EKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC-DKSFRSSSDLVRHQGVHTGEKPFSCSE 377

  Fly   342 CDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSF 406
            |.:.|..|...:.|: |:|..:|.   |.|:.|.|.:........|..||||||.|.|..|..||
Human   378 CGKSFSRSAYLADHQ-RIHTGEKP---FGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSF 438

  Fly   407 TRNSNLKTH 415
            .:.::|..|
Human   439 KQRAHLIAH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 6/20 (30%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 6/18 (33%)
C2H2 Zn finger 399..417 CDD:275368 6/17 (35%)
ZNF213NP_001128127.1 SCAN 41..145 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..188
KRAB_A-box 202..237 CDD:143639
COG5048 <315..451 CDD:227381 49/138 (36%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 347..367 CDD:275368 6/20 (30%)
C2H2 Zn finger 375..395 CDD:275368 6/20 (30%)
C2H2 Zn finger 403..423 CDD:275368 4/19 (21%)
C2H2 Zn finger 431..451 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.