DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF205

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001035893.1 Gene:ZNF205 / 7755 HGNCID:12996 Length:554 Species:Homo sapiens


Alignment Length:329 Identity:81/329 - (24%)
Similarity:132/329 - (40%) Gaps:68/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FEDIACEIPFSKED---DEQEQQQEYEDMVDKKTG----------------HDDGEESQECEESQ 190
            |||:|  :..|:|:   .:..||..|.|::.||.|                |..||.|....::.
Human   126 FEDVA--LYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAG 188

  Fly   191 PDEE---------ESQQNEEDEEESQEDDDELWQNEDG-----------------DSDTDADSMS 229
            .::|         |..|..:....:...:.:.::...|                 .|....||..
Human   189 DEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQ 253

  Fly   230 DIEATSRQSALDEDKKPR--RKY--------TKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDH 284
            ..|......|...|..|.  ::|        .::.:|::.:......::..||:|      .|:.
Human   254 PAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPDSEVGRKSY------RCEQ 312

  Fly   285 CGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHS 349
            |||.|:...:...|...|:|.||:.|.:|| |.|.|....|..::.|.|||||.|..|.:.|.|.
Human   313 CGKGFSWHSHLVTHRRTHTGEKPYACTDCG-KRFGRSSHLIQHQIIHTGEKPYTCPACRKSFSHH 376

  Fly   350 TMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKT 414
            :...:|: |:|..:|.   :.|:.|.||:........|:..|||.:...|.:|...||::|.|.|
Human   377 STLIQHQ-RIHTGEKP---YVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICAKCFTQSSALVT 437

  Fly   415 HYRS 418
            |.|:
Human   438 HQRT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 9/21 (43%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF205NP_001035893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
KRAB 124..>168 CDD:214630 13/43 (30%)
KRAB 124..161 CDD:279668 13/36 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..303 9/62 (15%)
COG5048 <306..486 CDD:227381 50/147 (34%)
C2H2 Zn finger 310..330 CDD:275368 6/19 (32%)
zf-H2C2_2 322..347 CDD:290200 10/25 (40%)
C2H2 Zn finger 338..358 CDD:275368 7/20 (35%)
zf-H2C2_2 350..375 CDD:290200 10/24 (42%)
C2H2 Zn finger 366..386 CDD:275368 6/20 (30%)
zf-H2C2_2 379..403 CDD:290200 8/27 (30%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
zf-H2C2_2 406..431 CDD:290200 7/24 (29%)
zf-C2H2 420..442 CDD:278523 9/22 (41%)
C2H2 Zn finger 422..442 CDD:275368 9/20 (45%)
zf-H2C2_2 434..459 CDD:290200 4/8 (50%)
C2H2 Zn finger 450..470 CDD:275368
zf-H2C2_2 462..487 CDD:290200
zf-C2H2 476..498 CDD:278523
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 490..515 CDD:290200
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.