DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF202

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001288708.1 Gene:ZNF202 / 7753 HGNCID:12994 Length:648 Species:Homo sapiens


Alignment Length:397 Identity:90/397 - (22%)
Similarity:141/397 - (35%) Gaps:112/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LEEDHDL-------YKKEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHDDG 180
            ||||..:       ..:.:|.|:|.|         |.|:..:..|.::.||.|.:....|| |..
Human   267 LEEDCGIVVSLSFPIPRPDEISQVRE---------EEPWVPDIQEPQETQEPEILSFTYTG-DRS 321

  Fly   181 EESQECEESQP-----------DEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEAT 234
            ::.:||.|.:.           .|.|..|..:.|...:::...|.:...|.:.:..:|..::..|
Human   322 KDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRET 386

  Fly   235 S--------------------------RQSALDEDKKP------RRKYTKRSS------------ 255
            :                          |.......:||      .:.||:.|.            
Human   387 TPVHPLLGRHHDCSVCGKSFTCNSHLVRHLRTHTGEKPYKCMECGKSYTRSSHLARHQKVHKMNA 451

  Fly   256 ----PKN-DDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQ 315
                |.| .:.:...|..:..:|...:|.:.||.|||.|....:...|...|:|.|||.|..||:
Human   452 PYKYPLNRKNLEETSPVTQAERTPSVEKPYRCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGK 516

  Fly   316 KEFNRYILNIHIRVKHRGEKPYACQFCDER----------------------------FVHSTMR 352
            ....:.:|..|.|: |.|.|||.|..|.|.                            |.||...
Human   517 SFSQKSVLTTHQRI-HLGGKPYLCGECGEDFSEHRRYLAHRKTHAAEELYLCSECGRCFTHSAAF 580

  Fly   353 SRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYR 417
            ::|    .|...:.:..:||.|.|.:.......:|:..||||:.|.|..|..||:|..:|..|.|
Human   581 AKH----LRGHASVRPCRCNECGKSFSRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQR 641

  Fly   418 SRQHQNK 424
            :  |..|
Human   642 T--HSEK 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 6/20 (30%)
C2H2 Zn finger 339..360 CDD:275368 7/48 (15%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 8/22 (36%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZNF202NP_001288708.1 SCAN 43..153 CDD:128708
SCAN 43..130 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..221
KRAB 237..297 CDD:214630 10/38 (26%)
KRAB 237..277 CDD:279668 4/9 (44%)
COG5048 397..>644 CDD:227381 60/253 (24%)
C2H2 Zn finger 399..419 CDD:275368 1/19 (5%)
zf-H2C2_2 411..436 CDD:290200 4/24 (17%)
C2H2 Zn finger 427..447 CDD:275368 3/19 (16%)
C2H2 Zn finger 483..503 CDD:275368 7/19 (37%)
zf-H2C2_2 495..520 CDD:290200 9/24 (38%)
C2H2 Zn finger 511..531 CDD:275368 6/20 (30%)
C2H2 Zn finger 539..559 CDD:275368 3/19 (16%)
C2H2 Zn finger 567..587 CDD:275368 5/23 (22%)
zf-C2H2 593..615 CDD:278523 5/21 (24%)
C2H2 Zn finger 595..615 CDD:275368 5/19 (26%)
zf-H2C2_2 607..632 CDD:290200 10/24 (42%)
C2H2 Zn finger 623..643 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.