DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF140

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_011533135.1 Gene:ZNF140 / 7699 HGNCID:12925 Length:458 Species:Homo sapiens


Alignment Length:145 Identity:50/145 - (34%)
Similarity:77/145 - (53%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 RKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEK 335
            ::|:..:|.:.|..|||.|:...|...|.:.|:|.||.||.:| .|.|:.....|..:..|.|||
Human   181 QRTHTGEKPYACKECGKTFSQISNLVKHQMIHTGKKPHECKDC-NKTFSYLSFLIEHQRTHTGEK 244

  Fly   336 PYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCE 400
            ||.|..|.:.|..::..:||: |:|..|   |.:.|..|.|.:.|..:..:|::.||||:.:.|.
Human   245 PYECTECGKAFSRASNLTRHQ-RIHIGK---KQYICRKCGKAFSSGSELIRHQITHTGEKPYECI 305

  Fly   401 VCKVSFTRNSNLKTH 415
            .|..:|.|.|:|..|
Human   306 ECGKAFRRFSHLTRH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 7/18 (39%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZNF140XP_011533135.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 160..>453 CDD:227381 50/145 (34%)
C2H2 Zn finger 164..184 CDD:275368 0/2 (0%)
zf-H2C2_2 176..201 CDD:290200 7/19 (37%)
C2H2 Zn finger 192..212 CDD:275368 7/19 (37%)
zf-H2C2_2 204..229 CDD:290200 11/25 (44%)
C2H2 Zn finger 220..240 CDD:275368 5/20 (25%)
zf-H2C2_2 233..257 CDD:290200 10/23 (43%)
C2H2 Zn finger 248..268 CDD:275368 6/20 (30%)
zf-H2C2_2 260..285 CDD:290200 9/28 (32%)
C2H2 Zn finger 276..296 CDD:275368 5/19 (26%)
zf-H2C2_2 288..313 CDD:290200 8/24 (33%)
C2H2 Zn finger 304..324 CDD:275368 7/17 (41%)
C2H2 Zn finger 332..352 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
zf-H2C2_2 372..397 CDD:290200
C2H2 Zn finger 388..408 CDD:275368
zf-H2C2_2 400..424 CDD:290200
C2H2 Zn finger 416..436 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.