DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF124

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001284497.1 Gene:ZNF124 / 7678 HGNCID:12907 Length:351 Species:Homo sapiens


Alignment Length:180 Identity:57/180 - (31%)
Similarity:86/180 - (47%) Gaps:19/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPEC 313
            |...|||...|          ..:|:..:|.:.|.||||.|......:.|...|:|.||:.|.||
Human   185 KAFSRSSHLRD----------HERTHTGEKPYECKHCGKAFRYSNCLHYHERTHTGEKPYVCMEC 239

  Fly   314 GQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRY 378
            |:.......|..||:. |.||:||.|:.|.:.|.:::...:|| :.|..:|.   :.||.|.|.:
Human   240 GKAFSCLSSLQGHIKA-HAGEEPYPCKQCGKAFRYASSLQKHE-KTHIAQKP---YVCNNCGKGF 299

  Fly   379 ESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNL----KTHYRSRQHQNK 424
            ..:.....||..||||:.:.|:.|..:|:|.|.|    |||...:.::.|
Human   300 RCSSSLRDHERTHTGEKPYECQKCGKAFSRASTLWKHKKTHTGEKPYKCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 9/26 (35%)
C2H2 Zn finger 399..417 CDD:275368 9/21 (43%)
ZNF124NP_001284497.1 KRAB 12..53 CDD:307490
C2H2 Zn finger 96..116 CDD:275368
C2H2 Zn finger 124..144 CDD:275368
C2H2 Zn finger 152..172 CDD:275368
COG5048 <176..338 CDD:227381 53/167 (32%)
C2H2 Zn finger 180..200 CDD:275368 5/24 (21%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.