DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF75D

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_009062.2 Gene:ZNF75D / 7626 HGNCID:13145 Length:510 Species:Homo sapiens


Alignment Length:453 Identity:104/453 - (22%)
Similarity:179/453 - (39%) Gaps:127/453 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WLTDHSKMPRNMCSCCLLSLKSAIAFRQ-ACIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLK 101
            |:..|.  |:|:....:|     :.|.| ....|.|.:|......||...|..|     ...|.|
Human   108 WVQKHH--PQNVKQALVL-----VEFLQREPDGTKNEVTAHELGKEAVLLGGTA-----VAPGFK 160

  Fly   102 INDAEVEQEVLYEVSYAD-----NEGL-----EEDHDLYKK---EEEESEVNENKE--------- 144
            ...||.:...:::..|.:     .|.|     :|...:|::   :::...::|.|.         
Human   161 WKPAEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASK 225

  Fly   145 -----------FEDIACEIPFSKEDDEQEQQQE---YEDMVDKKTGHDDGEESQECEESQPDEEE 195
                       |||:|  :.||:|:.:.....|   |.|::                        
Human   226 LILPESLSLLTFEDVA--VYFSEEEWQLLNPLEKTLYNDVM------------------------ 264

  Fly   196 SQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKND- 259
                 :|..|:........:|:.|:....:.|.|:|:.    |..:..||.|.|..:::..:.: 
Human   265 -----QDIYETVISLGLKLKNDTGNDHPISVSTSEIQT----SGCEVSKKTRMKIAQKTMGRENP 320

  Fly   260 -DTDFLK------PAKKKRKTY-----------------ISQKVHICDHCGKKFTDKGNFNLHVL 300
             ||..::      |.||::|..                 ..:|...|..|||.|....:...|..
Human   321 GDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHHR 385

  Fly   301 RHSGVKPFECPECGQK-----EFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH 360
            .|:|.||::|.:|.::     :.|::.:.      |:|.|||.|.:|.:.|.|:|....|: |:|
Human   386 IHTGEKPYKCQQCDRRFRWSSDLNKHFMT------HQGIKPYRCSWCGKSFSHNTNLHTHQ-RIH 443

  Fly   361 RNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTH---YRSRQ 420
            ..:|.   |||:.|.||:..|....||:..||||:.:.|.:||.:|:|.|:|..|   :|.|:
Human   444 TGEKP---FKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSLCKRNFSRRSSLLRHQKLHRRRE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 9/36 (25%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 3/25 (12%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 6/16 (38%)
zf-met 398..421 CDD:289631 10/26 (38%)
C2H2 Zn finger 399..417 CDD:275368 8/20 (40%)
ZNF75DNP_009062.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
SCAN 45..133 CDD:307924 7/31 (23%)
KRAB 234..275 CDD:307490 12/71 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..343 6/29 (21%)
zf-C2H2 365..387 CDD:306579 6/21 (29%)
C2H2 Zn finger 367..387 CDD:275368 6/19 (32%)
COG5048 <378..>492 CDD:227381 41/123 (33%)
C2H2 Zn finger 395..415 CDD:275368 3/25 (12%)
C2H2 Zn finger 423..443 CDD:275368 7/20 (35%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
C2H2 Zn finger 479..499 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.