DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN21

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001349708.1 Gene:ZSCAN21 / 7589 HGNCID:13104 Length:473 Species:Homo sapiens


Alignment Length:408 Identity:98/408 - (24%)
Similarity:157/408 - (38%) Gaps:101/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LTIQRRSVEAKDDGCWAD---PLSDAHEGLKINDAEVEQEVLYEVSYADNEGLEEDHDLYKKEEE 135
            |||..:.::|     |..   |.| |.|.:.:.: ::|:|:       |..|    |.:.....|
Human    94 LTILPQELQA-----WVQEHCPES-AEEAVTLLE-DLEREL-------DEPG----HQVSTPPNE 140

  Fly   136 ESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTG----HDDGEESQECEESQP--DEE 194
            :..|.|.......|.|.|.|.:....|...:||..     |    .:.|||.:..::.:.  |..
Human   141 QKPVWEKISSSGTAKESPSSMQPQPLETSHKYESW-----GPLYIQESGEEQEFAQDPRKVRDCR 200

  Fly   195 ESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEATSRQSA-------LDEDKKPRRKYTK 252
            .|.|:||..:|.:..:.|         ....|.:|.|.|...:::       |:.:|..:....:
Human   201 LSTQHEESADEQKGSEAE---------GLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQE 256

  Fly   253 RSSPKNDDTDFLKPA---------------------KKKRKTYISQKVHICDHCGKKFTDKGNFN 296
            ..|.|..::...||.                     .|.|:|:..:|.::|..|||.|:...|..
Human   257 AGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLT 321

  Fly   297 LH-----------------------VLRHSGV----KPFECPECGQKEFNRYILNIHIRVKHRGE 334
            ||                       :|:|..:    .|::|.:||:....:..|..|.|: |.||
Human   322 LHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRI-HTGE 385

  Fly   335 KPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHC 399
            |||.|..|.:.|......|.|: |:|..:|.   :||..|.|.:..:....||..:||||:.:.|
Human   386 KPYQCNECGKSFSQHAGLSSHQ-RLHTGEKP---YKCKECGKAFNHSSNFNKHHRIHTGEKPYWC 446

  Fly   400 EVCKVSFTRNSNLKTHYR 417
            ..|..:|...|||..|.|
Human   447 HHCGKTFCSKSNLSKHQR 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 98/408 (24%)
C2H2 Zn finger 282..302 CDD:275368 9/42 (21%)
C2H2 Zn finger 310..331 CDD:275368 6/20 (30%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 8/20 (40%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZSCAN21NP_001349708.1 SCAN 42..153 CDD:128708 17/76 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..169 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..272 6/27 (22%)
COG5048 <276..453 CDD:227381 47/181 (26%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..354 CDD:275368 2/16 (13%)
C2H2 Zn finger 362..382 CDD:275368 6/20 (30%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-C2H2 446..466 CDD:395048 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.