DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN20

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001364305.1 Gene:ZSCAN20 / 7579 HGNCID:13093 Length:1043 Species:Homo sapiens


Alignment Length:343 Identity:88/343 - (25%)
Similarity:134/343 - (39%) Gaps:91/343 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 SKEDDEQEQQQEY--EDMVDKKT----GHDDGEESQECEESQ-----------------PDEEES 196
            |.|.|.||...|.  ||.|...|    ..|.|.|.:..:|.|                 |.|...
Human   594 SAETDAQEAWGEVANEDAVKPSTLCPKAPDMGFEMRHEDEDQISEQDIFEGLPGALSKCPTEAVC 658

  Fly   197 QQNEEDEEESQEDDDE-LWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRR-----KYTKRSS 255
            |..:..|:...|::|| .|.|...:...::.|..|:|.......|...:||.:     |...|||
Human   659 QPLDWGEDSENENEDEGQWGNPSQEQWQESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSS 723

  Fly   256 PKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNR 320
                  .|:    ..::.:..:|.:.|..|||.|:|:.|.|.|...|:|.||::|.|||:...:.
Human   724 ------HFI----AHQRIHTGEKPYKCLECGKNFSDRSNLNTHQRIHTGEKPYKCLECGKSFSDH 778

  Fly   321 YILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH------------------------- 360
            ..|..|.|: |.|||||.|..|.:.|..|:...:|: |:|                         
Human   779 SNLITHQRI-HTGEKPYKCGECWKSFNQSSNLLKHQ-RIHLGGNPDQCSEPGGNFAQSPSFSAHW 841

  Fly   361 RNK----------------KTP---------KNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCE 400
            ||.                .:|         |.::|:.|.:.:..:.....|:.:||||:.:.|.
Human   842 RNSTEETAPEQPQSISKDLNSPGPHSTNSGEKLYECSECGRSFSKSSALISHQRIHTGEKPYECA 906

  Fly   401 VCKVSFTRNSNLKTHYRS 418
            .|..||:::|.|..|.|:
Human   907 ECGKSFSKSSTLANHQRT 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 9/19 (47%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 2/16 (13%)
zf-met 398..421 CDD:289631 8/21 (38%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZSCAN20NP_001364305.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SCAN 47..132 CDD:396558
Myb_DNA-bind_4 323..404 CDD:404682
Myb_DNA-bind_4 483..564 CDD:404682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 661..692 7/30 (23%)
COG5048 699..>1029 CDD:227381 61/238 (26%)
C2H2 Zn finger 712..732 CDD:275368 5/29 (17%)
C2H2 Zn finger 740..760 CDD:275368 9/19 (47%)
C2H2 Zn finger 768..788 CDD:275368 7/20 (35%)
C2H2 Zn finger 796..816 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 835..873 3/37 (8%)
C2H2 Zn finger 877..897 CDD:275368 3/19 (16%)
C2H2 Zn finger 905..925 CDD:275368 8/20 (40%)
C2H2 Zn finger 933..953 CDD:275368
C2H2 Zn finger 961..981 CDD:275368
C2H2 Zn finger 989..1009 CDD:275368
C2H2 Zn finger 1017..1037 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.