DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF19

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_008892.2 Gene:ZNF19 / 7567 HGNCID:12981 Length:458 Species:Homo sapiens


Alignment Length:255 Identity:76/255 - (29%)
Similarity:111/255 - (43%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ESQEDDD-ELWQNEDGDSDTDADSMSDIEATSRQSALDE----------DKKPRRK--YTKRSSP 256
            |:|:|.. |..:|...|.:|:.||    |:|..|...:|          ...|:|.  ...|:..
Human    76 EAQDDPPAERTKNVCKDVETNIDS----ESTLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVE 136

  Fly   257 KNDDTDFLKPAK-KKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFN- 319
            |:.|...:|..: |..:...::|..||:.|||.|:....:..|...|:|.|||||.||| |.|| 
Human   137 KHQDIPTVKNIQGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECG-KAFNG 200

  Fly   320 RYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHE---------------------------N 357
            ...|..|.|: |.||:||.|:.|...|..:....||:                           .
Human   201 NSSLIRHQRI-HTGERPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQ 264

  Fly   358 RVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYR 417
            |:|..:|.   ::||.|.|.:..|....:|:.:||||:.:.|..|..||.|.|:|..|.|
Human   265 RIHTGEKP---YECNECGKAFVGNSPLLRHQKIHTGEKPYECNECGKSFGRTSHLSQHQR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 10/21 (48%)
C2H2 Zn finger 339..360 CDD:275368 6/47 (13%)
C2H2 Zn finger 371..388 CDD:275370 5/16 (31%)
zf-met 398..421 CDD:289631 9/20 (45%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF19NP_008892.2 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
COG5048 <96..426 CDD:227381 69/235 (29%)
C2H2 Zn finger 163..183 CDD:275368 6/19 (32%)
zf-H2C2_2 178..199 CDD:290200 12/21 (57%)
C2H2 Zn finger 191..211 CDD:275368 10/21 (48%)
zf-H2C2_2 203..227 CDD:290200 10/24 (42%)
C2H2 Zn finger 219..239 CDD:275368 5/19 (26%)
zf-H2C2_2 231..256 CDD:290200 2/24 (8%)
C2H2 Zn finger 247..267 CDD:275368 1/19 (5%)
zf-H2C2_2 263..283 CDD:290200 7/22 (32%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-H2C2_2 288..312 CDD:290200 9/23 (39%)
C2H2 Zn finger 303..323 CDD:275368 9/19 (47%)
zf-H2C2_2 315..339 CDD:290200 3/7 (43%)
C2H2 Zn finger 331..351 CDD:275368
zf-H2C2_2 344..367 CDD:290200
C2H2 Zn finger 359..379 CDD:275368
zf-H2C2_2 372..393 CDD:290200
C2H2 Zn finger 387..407 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.